KEGG   Cicer arietinum (chickpea): 101490229Help
Entry
101490229         CDS       T02819                                 

Definition
glutamate dehydrogenase 2-like
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    101490229
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101490229
   00330 Arginine and proline metabolism
    101490229
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    101490229
Enzymes [BR:cam01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     101490229
Exosome [BR:cam04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101490229
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca8
AA seq 411 aa AA seqDB search
MNALVATNRNFLRASRILGLDSKLENSLLIPFREIKVECTIPKDDGSLVSYVGFRIQHDN
ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVVDLPYGGAKGGIGCNPKDLSLSELERL
TRVFTQKIHDLIGTQRDVPAPDMGTNSQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLG
REAATGVGVVFATEALFAEYGKSISDMTFAIQGFGNVGSWAAKSIFERGGKVVAVSDISG
AIKNPNGIDIAALLKHKEANGSLNDFSGGDVMDPNELLVHECDVLIPCALGGVLNKENAN
DVKAKFIIEAANHPTDPDADEILSKKGVIILPDIYANAGGVTVSYFEWVQNIQGFMWDEE
KVNRELKKYMTKAFLNIKATCKIHNCDLRMGAFTLGLNRVARATLLRGWEA
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctcttgttgccaccaaccgtaacttcctacgtgcctctcgaattctcggtttg
gattccaaacttgagaatagccttctcattcccttcagagaaatcaaagttgaatgtacg
atcccgaaagatgatggaagtttggtttcctatgttggtttcagaattcaacatgacaat
gctcgtggacctatgaaaggaggaattcgttatcatcctgaggttgatcctgatgaagtg
aatgctctagcacagctaatgacatggaagacagctgtggtagatcttccctatggagga
gcaaagggtggaatcggctgcaacccgaaggacctgagcctcagcgagctggaacggctc
acgcgtgttttcactcaaaagattcatgatctcattggcactcagagagatgttcctgct
cctgatatgggaactaattcacagacaatggcttggattcttgacgagtattcaaagttt
catggtcattcaccagcagttgtaactggcaagcctattgatcttggaggttcattggga
agagaggctgcaacaggagtaggagtggtttttgcaacagaggctttatttgctgaatat
ggaaagtcaatttctgacatgacatttgccatccaggggtttggaaatgtgggctcttgg
gctgcaaagtcaatatttgagagagggggtaaggtggttgcagtgagtgatatcagtggt
gctattaaaaacccaaatgggattgatattgctgctcttctaaaacacaaggaagccaat
ggaagtttgaatgatttctcaggaggagatgttatggatccaaatgaattgcttgttcat
gaatgtgatgttctcatcccatgtgctttgggaggtgttctcaacaaggaaaatgctaat
gatgtgaaagcaaaatttattatagaagctgcaaatcatccaactgatccagatgctgat
gagatactgtctaagaaaggagtgattatattacctgacatttatgccaatgctggtgga
gtgacagtaagttactttgagtgggttcagaatattcaaggatttatgtgggatgaagag
aaagtgaaccgtgagctaaaaaagtacatgaccaaagctttcttgaacataaaggcaaca
tgtaaaattcacaattgtgacctgcgaatgggagctttcactcttggactcaaccgtgtt
gctcgtgctacacttttgaggggttgggaagcttag

DBGET integrated database retrieval system