KEGG   Cicer arietinum (chickpea): 101490229Help
Entry
101490229         CDS       T02819                                 

Definition
(RefSeq) glutamate dehydrogenase 2-like
  KO
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101490229
  Energy metabolism
   00910 Nitrogen metabolism
    101490229
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101490229
   00330 Arginine and proline metabolism
    101490229
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    101490229
Enzymes [BR:cam01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     101490229
Exosome [BR:cam04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101490229
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca8
AA seq 411 aa AA seqDB search
MNALVATNRNFLRASRILGLDSKLENSLLIPFREIKVECTIPKDDGSLVSYVGFRIQHDN
ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVVDLPYGGAKGGIGCNPKDLSLSELERL
TRVFTQKIHDLIGTQRDVPAPDMGTNSQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLG
REAATGVGVVFATEALFAEYGKSISDMTFAIQGFGNVGSWAAKSIFERGGKVVAVSDISG
AIKNPNGIDIAALLKHKEANGSLNDFSGGDVMDPNELLVHECDVLIPCALGGVLNKENAN
DVKAKFIIEAANHPTDPDADEILSKKGVIILPDIYANAGGVTVSYFEWVQNIQGFMWDEE
KVNRELKKYMTKAFLNIKATCKIHNCDLRMGAFTLGLNRVARATLLRGWEA
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctcttgttgccaccaaccgtaacttcctacgtgcctctcgaattctcggtttg
gattccaaacttgagaatagccttctcattcccttcagagaaatcaaagttgaatgtacg
atcccgaaagatgatggaagtttggtttcctatgttggtttcagaattcaacatgacaat
gctcgtggacctatgaaaggaggaattcgttatcatcctgaggttgatcctgatgaagtg
aatgctctagcacagctaatgacatggaagacagctgtggtagatcttccctatggagga
gcaaagggtggaatcggctgcaacccgaaggacctgagcctcagcgagctggaacggctc
acgcgtgttttcactcaaaagattcatgatctcattggcactcagagagatgttcctgct
cctgatatgggaactaattcacagacaatggcttggattcttgacgagtattcaaagttt
catggtcattcaccagcagttgtaactggcaagcctattgatcttggaggttcattggga
agagaggctgcaacaggagtaggagtggtttttgcaacagaggctttatttgctgaatat
ggaaagtcaatttctgacatgacatttgccatccaggggtttggaaatgtgggctcttgg
gctgcaaagtcaatatttgagagagggggtaaggtggttgcagtgagtgatatcagtggt
gctattaaaaacccaaatgggattgatattgctgctcttctaaaacacaaggaagccaat
ggaagtttgaatgatttctcaggaggagatgttatggatccaaatgaattgcttgttcat
gaatgtgatgttctcatcccatgtgctttgggaggtgttctcaacaaggaaaatgctaat
gatgtgaaagcaaaatttattatagaagctgcaaatcatccaactgatccagatgctgat
gagatactgtctaagaaaggagtgattatattacctgacatttatgccaatgctggtgga
gtgacagtaagttactttgagtgggttcagaatattcaaggatttatgtgggatgaagag
aaagtgaaccgtgagctaaaaaagtacatgaccaaagctttcttgaacataaaggcaaca
tgtaaaattcacaattgtgacctgcgaatgggagctttcactcttggactcaaccgtgtt
gctcgtgctacacttttgaggggttgggaagcttag

DBGET integrated database retrieval system