KEGG   Cicer arietinum (chickpea): 101491433Help
Entry
101491433         CDS       T02819                                 

Definition
putative pectinesterase/pectinesterase inhibitor 22-like
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:cam00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cam00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca3
AA seq 543 aa AA seqDB search
MAMLVNCLFILILLPSFDKVLSFQDEIPSEIQTQDMQALIAQACMDIENQNSCLTNIQNE
LTKTGPPSPTSVISAALRTTINEAIGAINNMTKISTFSVNNREQLAIEDCKELIDFSVSE
LAWSLGEMRRIRAGDRNAQYEGNLEAWLSAALSNQDTCIEGFEGTDRRLESFISGSLTQV
TQLISNVLSLYTQLHRLPFRSPRNTTLLGTSDVSSEFPEWMTDADQELLKSRPHGAVANA
IVALDGSGHYRTINEAVNAAPSHSNRRYVIYVKKGLYKENVDMKKKMTNIMIVGDGIGQT
IITSNRNFMQGWTTFRTATFAVSGKGFIAKDVTFRNTAGPVNHQAVALRVDSDQSAFFRC
SIEGNQDTLYAHSLRQFYRECEIYGTIDFIFGNGAAVLQNCKIYTRVPLPLQKVTITAQG
RKSPHQSTGFTIQDSYVLASQPTYLGRPWKQYSRTVYINTYMSGMVQPRGWLEWLGNFAL
DTLWYGEYRNYGPGSSLAGRVKWPGFHIIKDASTAGYFTVQKFLNGGSWLPKTGVKFTAG
LTN
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggccatgcttgttaattgccttttcattctcatccttttaccatcatttgataaagta
ctttcattccaagatgaaattccctcagaaatccaaacacaagacatgcaagctttgatt
gctcaagcctgcatggatatcgaaaaccaaaactcatgcctcacaaatattcaaaacgag
ttaacgaaaaccggccctccaagtccaacttcagtcatcagtgctgcactcagaaccaca
atcaatgaagccataggtgccatcaataacatgacaaagatcagtactttttctgttaat
aaccgcgagcaactagccatagaagattgcaaggagcttattgatttctctgtgtcagag
ctagcatggtcattaggtgagatgaggagaattcgagcaggcgatagaaatgcgcaatac
gaaggaaacctcgaagcttggttaagtgcagcacttagtaaccaagatacatgtattgaa
gggtttgaaggtactgatagacgccttgagagtttcatcagtggaagtttaacacaagtc
acacagcttatcagtaatgttctgtctttgtatactcaacttcatagattaccctttagg
tctccgaggaacactacattgctcggaacaagcgatgtaagctcggagtttcccgaatgg
atgaccgatgctgatcaagagctccttaagtcaagaccgcacggtgcggttgcaaatgcg
attgttgcattggatgggagtggtcattaccgtacgatcaacgaagcggttaatgcagct
ccaagtcatagcaataggaggtatgttatctatgtgaagaagggactttacaaggagaat
gttgatatgaagaagaagatgaccaacattatgatcgttggtgatggtattggccaaact
attatcacaagcaacagaaatttcatgcaaggatggaccacttttagaactgccacgttt
gctgtatctgggaagggtttcattgcaaaggacgtgacattccggaacactgctggacca
gtaaaccatcaagcagtggcattgcgggtggattcagaccaatctgcattctttaggtgc
agtatagaaggaaaccaagacaccctttacgcgcactcgctgcgacaattctaccgtgaa
tgtgaaatctatggaacaatagacttcatttttggcaatggagctgctgttctacaaaac
tgcaagatatacacaagagttccacttccattacaaaaagttacaatcacagcacaaggt
agaaaaagtccacatcaaagcacaggttttacaattcaagatagttatgttttggcctca
caacctacatatttagggaggccatggaagcaatattctagaacagtttacattaacaca
tatatgagtggaatggttcaacctagagggtggcttgaatggcttggaaactttgcattg
gacactttgtggtatggtgaatatagaaattatggacctggttcatcccttgctggtaga
gttaaatggcctggttttcatatcattaaagatgcttctactgctggttactttactgtt
cagaaattccttaatggtggttcatggttgccaaaaacaggtgtcaagttcacagcagga
ttgaccaattga

DBGET integrated database retrieval system