KEGG   Cicer arietinum (chickpea): 101492705Help
Entry
101492705         CDS       T02819                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial-like
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00020  Citrate cycle (TCA cycle)
cam00190  Oxidative phosphorylation
cam01100  Metabolic pathways
cam01110  Biosynthesis of secondary metabolites
cam01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101492705
  Energy metabolism
   00190 Oxidative phosphorylation
    101492705
Enzymes [BR:cam01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101492705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer2 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 101492705
NCBI-ProteinID: XP_004488937
UniProt: A0A1S2XGB7
Position
Ca1
AA seq 279 aa AA seqDB search
MATGMLKRAIYRFSTTSPASRLTLLRAHASEAQAQQVEPKARDTTSLKKFQIYRWNPDSP
TKPELKEYEINLKECGPMVLDALIKIKNDIDPSLTFRRSCREGICGSCAMNIDGCNGLAC
LTKIPSEGSDTTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPSEPGKEILQSK
KDRAKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHANRWISDSRDEYTKERLEAV
NDEFKLYRCHTILNCARACPKGLNPGKQIAHIKSLQPKA
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagggatgctgaaaagagctatctacaggttctcaactacttccccagcatcg
aggctaaccctcctccgagctcacgcatccgaagcccaagcccagcaagttgaacccaaa
gcccgtgataccacctccctgaaaaaattccaaatctaccgatggaacccggacagcccc
acaaagccagagctaaaggaatacgagatcaacctaaaggagtgtgggcccatggtcctc
gatgctctaatcaagatcaagaacgacatcgatccaagcctaacgtttcgtcgctcttgc
cgcgaaggaatctgcggttcatgcgcgatgaacatcgacggctgtaacggactcgcttgt
ttgacgaaaataccatcggagggttcggatacaacgataactccacttcctcatatgttt
gtgataaaggatcttgtggttgatatgacgaatttttataatcagtataagagtattgag
ccgtggttgaagaggaagaatccaccttccgaacctgggaaggagattcttcagagtaag
aaggatcgtgctaagcttgatgggatgtatgagtgtatactgtgtgcttgctgcagcaca
tcatgccctagttattggtggaatcctgagtcttatcttggtcccgctgctttgcttcat
gctaacaggtggataagtgacagccgtgacgagtacactaaggagagattggaagctgta
aatgatgaattcaagctctaccgctgccacaccatattgaactgtgcccgtgcctgtcca
aaggggttgaaccctggaaagcaaattgcacatatcaagtcgcttcagccaaaagcttaa

DBGET integrated database retrieval system