KEGG   Cicer arietinum (chickpea): 101492705Help
Entry
101492705         CDS       T02819                                 

Definition
succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial-like
Orthology
K00235  
succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101492705
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101492705
  Energy metabolism
   00190 Oxidative phosphorylation
    101492705
Enzymes [BR:cam01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101492705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca1
AA seq 279 aa AA seqDB search
MATGMLKRAIYRFSTTSPASRLTLLRAHASEAQAQQVEPKARDTTSLKKFQIYRWNPDSP
TKPELKEYEINLKECGPMVLDALIKIKNDIDPSLTFRRSCREGICGSCAMNIDGCNGLAC
LTKIPSEGSDTTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPPSEPGKEILQSK
KDRAKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHANRWISDSRDEYTKERLEAV
NDEFKLYRCHTILNCARACPKGLNPGKQIAHIKSLQPKA
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagggatgctgaaaagagctatctacaggttctcaactacttccccagcatcg
aggctaaccctcctccgagctcacgcatccgaagcccaagcccagcaagttgaacccaaa
gcccgtgataccacctccctgaaaaaattccaaatctaccgatggaacccggacagcccc
acaaagccagagctaaaggaatacgagatcaacctaaaggagtgtgggcccatggtcctc
gatgctctaatcaagatcaagaacgacatcgatccaagcctaacgtttcgtcgctcttgc
cgcgaaggaatctgcggttcatgcgcgatgaacatcgacggctgtaacggactcgcttgt
ttgacgaaaataccatcggagggttcggatacaacgataactccacttcctcatatgttt
gtgataaaggatcttgtggttgatatgacgaatttttataatcagtataagagtattgag
ccgtggttgaagaggaagaatccaccttccgaacctgggaaggagattcttcagagtaag
aaggatcgtgctaagcttgatgggatgtatgagtgtatactgtgtgcttgctgcagcaca
tcatgccctagttattggtggaatcctgagtcttatcttggtcccgctgctttgcttcat
gctaacaggtggataagtgacagccgtgacgagtacactaaggagagattggaagctgta
aatgatgaattcaagctctaccgctgccacaccatattgaactgtgcccgtgcctgtcca
aaggggttgaaccctggaaagcaaattgcacatatcaagtcgcttcagccaaaagcttaa

DBGET integrated database retrieval system