KEGG   Cicer arietinum (chickpea): 101494384Help
Entry
101494384         CDS       T02819                                 

Definition
elongator complex protein 3-like
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
cam  Cicer arietinum (chickpea)
Brite
Enzymes [BR:cam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101494384
Transfer RNA biogenesis [BR:cam03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    101494384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca5
AA seq 563 aa AA seqDB search
MAAAAVADARKAPRPGKGGFEGHGLSEEEARVRAIAEIVNSMVDLSHKGHKVDLNALKSA
ACRKYGLSRAPKLVEMIAALPDSEREALLPKLRAKPVRTASGIAVVAVMSKPHRCPHIAT
TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNPYVQARGRIDQLKRLGHSVDK
VEFILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAVAYSEHSATKCIGMTIETRP
DYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVVAH
MMPDLPNVGVERDMESFREFFESPLFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPPEQ
LVDIVARILALVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMEDLGLKCRDVRTR
EAGIQDIHHQIKPEEVELVRRDYMANEGWETFLSYEDTRQDILVGLLRLRKCGRNTTCPE
LMGKCSIVRELHVYGTAVPVHGRESDKLQHQGYGTLLMEEAERIASKEHRSTKIAVISGV
GTRHYYRKLGYELEGPYMVKCLM
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcagcggtggcagatgcaagaaaggcaccacggccaggaaaaggaggcttc
gaaggccacggcctcagcgaagaggaggcgcgtgtacgagccatagcagaaatcgtgaac
tccatggtcgacctatctcataaaggtcacaaagtcgatctcaatgctctcaagtccgcc
gcgtgccgtaaatacggcctctcacgtgcgcccaagctcgttgaaatgatcgccgcttta
cctgactccgaacgagaggctctccttcccaaactccgagccaaacccgtccgaactgct
tctggaattgccgtcgttgccgtcatgtcgaagcctcatcgttgtcctcacatcgccact
accggtaatatctgtgtttactgccccggtggtcctgattccgattttgaatacagtact
cagtcttatactggttatgaacctactagtatgcgtgcaattcgagctaggtataaccct
tatgtgcaggcaagaggtaggatagatcagcttaagcgtttaggtcacagtgtagacaag
gttgagtttatcctaatgggtggaactttcatgtcacttccggcagattaccgtgattat
tttataagaaatcttcacgatgctttgtctggacacacctctgccaatgtagaagaggcg
gtggcatactctgagcacagtgcaaccaagtgtattggcatgacaattgaaacgaggcct
gattattgcctaggacctcacctgcgacaaatgctttcttatggttgtacacgattggag
attggagtccaaagcacctatgaggatgttgctcgtgacaccaatagaggacataccgta
gctgctgtagctgattgtttttgcctggctaaagatgccggtttcaaggtagttgctcac
atgatgcctgatcttccaaatgttggtgttgaaagggacatggaaagtttccgagagttt
tttgaaagtcccttgtttagagcagacgggcttaaaatataccccactcttgtaatacgt
ggaactgggctgtatgagctctggaaaactggcaggtatagaaattatccacctgagcaa
cttgtggacatcgtagcaaggatccttgcactggtacccccgtggacacgtgtttataga
gttcagcgggatattccgatgccattggttacctctggagttgagaaagggaatctaagg
gagctagcattagcacgaatggaagacctgggattaaaatgtcgtgatgttcggaccaga
gaagctggaatccaggatattcatcaccaaattaagccagaagaggttgaacttgttcgt
cgtgattatatggcaaatgaaggttgggaaacatttctgtcatatgaagatacacgacaa
gatatcctcgttggtttgttgcgactgagaaaatgtggccggaacactacttgtccagag
cttatggggaaatgttctattgttcgtgagcttcacgtttatggaactgctgtaccagtt
catggacgggaatctgacaagctacaacaccagggttatggtacacttcttatggaggag
gcagagcggattgccagcaaagaacacagatcaactaagatagctgtaatttctggggtt
ggcacgcgccattattacagaaaattgggatatgagcttgaagggccttacatggtgaaa
tgtctaatgtaa

DBGET integrated database retrieval system