KEGG   Cicer arietinum (chickpea): 101494843Help
Entry
101494843         CDS       T02819                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L3-like
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
cam  Cicer arietinum (chickpea)
Brite
Enzymes [BR:cam01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101494843
Peptidases [BR:cam01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   101494843
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca7
AA seq 229 aa AA seqDB search
MASPTPKRWLPLEANPDVMNQFLFGLGLPEDQAECNDVYGLDDELLEMVPKPVLAVLFLY
PLTTKSEEERLRQINEKREYSNKVYFMKQTVGNACGTIGLLHALGNITSEIKFVEGSFFD
KFFKSTANLDPMQRALFLENDTEMEVAHSVAATAGDTEASDNVDTHFICFACVDGELYEL
DGRKSGAISHGPSSPSTLLKDAAKAIQSMIQKNPDSLNFNVIALSKKSQ
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcctactccgaaaagatggcttcctcttgaagctaaccctgatgtcatgaac
cagtttctttttggtcttggtcttcctgaggatcaagctgagtgcaatgatgtatacgga
ttagatgatgagcttttggaaatggttccaaagcctgttcttgctgtgctttttctttat
ccccttaccaccaagagtgaagaagagaggttgcgacagataaatgaaaaaagggaatat
agcaacaaagtgtattttatgaagcaaactgtgggtaatgcttgtggtacaataggactt
cttcatgctctcggtaacataacttctgaaatcaagtttgttgagggttcattctttgat
aagtttttcaaatctaccgcaaacttggacccaatgcagcgtgctttgtttcttgagaat
gatactgagatggaggttgctcattctgtagcagccactgctggtgatacagaggcatca
gacaatgtggatactcatttcatctgctttgcttgtgtggatggtgaactttatgagctt
gatggaagaaagtcaggagcaatatctcatggtccatcctcaccaagtactttgttgaag
gatgcagctaaagccatccagagcatgatccagaagaatccagattccctcaacttcaat
gtcattgcattatcaaagaaatcccagtga

DBGET integrated database retrieval system