KEGG   Cicer arietinum (chickpea): 101496188Help
Entry
101496188         CDS       T02819                                 

Definition
(RefSeq) beta-fructofuranosidase, cell wall isozyme-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    101496188
   00500 Starch and sucrose metabolism
    101496188
Enzymes [BR:cam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     101496188
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Un
AA seq 265 aa AA seqDB search
MTLRLHRKNISSWVLISGDIVPAVSEKACYPVEAVFEKACYRGAYKALVSLVIPTNASTW
ALIGCWLCFPSFFSMVLPILKLYKPSFHFQPHKNWMNDPNGPMRYKGLYHMFYQHNPKGA
IWSNNSIVWGHSISKDLVNWLSLQHALIPSESHDINGCWSGSSTLLPNDKPKILYTGIDI
NQHQTQNLAIPKNVSDPLLREWIKSPNNVNKINATSYRDPTTAWIGHHDGFWRVLIGSQK
KDKGILILFKRFDPCIVLGETVTNL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgagattgcaccggaagaatatctcctcatgggttctcatttccggcgacatt
gttccagcagtttccgagaaagcctgttacccggttgaagcagttttcgaaaaagcttgt
taccggggtgcttacaaggcactagtttccttagtcattcctacaaacgcttccacatgg
gcacttattggttgttggctatgttttccttctttcttttctatggtgttgcccatattg
aagctttataaaccttcttttcacttccaacctcacaagaattggatgaatgaccctaat
ggccctatgagatacaagggactataccatatgttctaccaacacaatccaaaaggtgca
atatggagcaacaatagtattgtttggggccattctatttcaaaggatctagtgaattgg
ttatcattacaacatgctcttattccaagtgaatcacatgatatcaatggttgttggtca
ggttcatccacacttctccctaatgacaaaccaaaaatcttatacacaggaattgacatt
aatcaacaccaaactcaaaatttggccatacccaaaaatgtgtctgacccattacttagg
gaatggataaaatcaccgaataatgttaacaaaattaatgcaacttcatatagagaccct
accactgcttggattggtcatcatgatggattttggagagtacttattggaagccaaaaa
aaggacaagggaattttaattttatttaaaagatttgacccttgcattgtccttggtgag
acggttaccaatttataa

DBGET integrated database retrieval system