KEGG   Cicer arietinum (chickpea): 101496418Help
Entry
101496418         CDS       T02819                                 

Definition
NAD-dependent protein deacetylase SRT1-like
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
cam  Cicer arietinum (chickpea)
Brite
Enzymes [BR:cam01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101496418
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 471 aa AA seqDB search
MSLGYAEKLSFIEDVGNVGMTEHFDSSHVLREKIERLAIMIKKSKHLVVFTGAGISTSCG
IPDFRGPKGIWTLQREGKALPEASLPFHRAMPSLTHMALVELEKNGILKFVISQNVDGLH
LRSGIPREKLAELHGNSFMETCPSCGAEYFRDFEVETIGLKETSRRCSDEKCGTRLKDTV
LDWEDALPPKEMDPAEKHCKQADIVLCLGTSLQITPACNLPLKALRGGGKVVIVNLQKTP
KDKNASLVIHGFVDKVITGVMEYLNLKIPPFIRIDLFQIIVVHALSIDKRYVNWTLQVAS
AHAQKASLPFIKSVEVSFLDKEDYKAAILDKQPFRLKRRTAYNKAFEMVLKLNFGDGCGC
SSLEIDVPIDFMTSTDCFNFDKDIIFQKLRDKAVVESKCGQNAVIERKTILTPKSDVTTY
AIVTNVVHYSNAVPDSLTNGDLKKRKESTTGTGSSKKRSKVSKGKSISKKS
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttgggtatgctgaaaaactttccttcattgaagatgttggaaacgttggaatg
accgaacatttcgattcatctcacgttttgcgtgaaaaaatagagcgacttgctatcatg
attaaaaagagtaagcatctagtagtgtttacaggtgcaggcatatcaacttcttgtggt
atacctgattttcgaggtcccaagggaatttggacgcttcagcgtgaaggtaaagccttg
cctgaagcatcattaccatttcaccgtgcgatgccaagcttgactcacatggctttagtt
gaattagaaaagaatggtattttgaagtttgttatcagccagaatgttgatggactccat
cttcgatctggtataccaagggaaaaactggctgaactgcacgggaattcgtttatggaa
acttgcccttcttgtggagccgagtactttcgcgattttgaggtagaaactattggttta
aaggagacgtcacggcgctgttcagatgaaaaatgtgggacaagacttaaggatacagtc
cttgactgggaggatgccttacctccaaaggagatggatcctgctgagaagcactgcaaa
caggcagatatagtgttatgcttagggacaagtctgcaaataactccagcatgcaacttg
cctcttaaagcacttcgcggtggaggtaaagttgtcattgtaaatctccagaaaacccca
aaggacaaaaatgcctctttagtcatacacgggtttgtcgataaggtaattactggtgtc
atggagtaccttaatctgaagattcctcctttcatcaggattgaccttttccagattatt
gtagtgcatgctttgagcattgataaaagatatgtgaactggactctccaagttgcaagt
gctcatgcccagaaagcatcactgcctttcatcaagtccgtcgaggtttctttcttggac
aaggaagattacaaagcagccattctggataagcaaccatttcgacttaaaaggagaaca
gcatataacaaagcatttgaaatggttcttaaactcaattttggtgatggctgcggttgc
tcgtcccttgaaattgatgtcccgattgattttatgacatcaactgactgcttcaacttt
gacaaggatatcattttccaaaagctgagagacaaagcagttgttgaatcaaaatgtggt
cagaatgctgttattgagagaaagacaatcttgacaccaaaaagtgatgttactacctat
gctatcgtcacgaatgttgttcattacagcaatgcagtccctgattctctaacaaatggc
gatcttaaaaagagaaaagaaagcacgacaggtacaggatcgtctaagaagcgttcaaaa
gtttccaagggtaaatctatatcaaaaaagtcttag

DBGET integrated database retrieval system