KEGG   Cicer arietinum (chickpea): 101496711Help
Entry
101496711         CDS       T02819                                 

Definition
josephin-like protein-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
cam  Cicer arietinum (chickpea)
Brite
Enzymes [BR:cam01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101496711
Peptidases [BR:cam01002]
 Cysteine Peptidases
  Family C86
   101496711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca2
AA seq 184 aa AA seqDB search
MSTENSRVYHERQRLQFCLLHTLNSLFQQKDAFTRSSLNAISEKLALDDVSSNTESWTPF
SVLFKPHHNALTGNYDINVLIAAXXXXKSVVWHDRRNGGSSIDLDAPEDVLMGVVINVPV
KRFAGIWKSRHWIALRKIDGVWYNLDSDLSAPQCFRDTEKVREFLDFSIVHGGEVLLVMN
HKQS
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactgagaattcccgtgtctatcacgaaagacaaagattacagttctgtctctta
catactctcaactcactctttcagcaaaaagatgcttttactagatcaagtttgaatgca
atttctgaaaaactagcacttgatgatgtttcctccaacactgaatcttggacaccattt
tctgtccttttcaaaccccatcataatgctttgactggaaactatgacataaatgttcta
atagctgcttnnnnnnnnnnaaagagtgtggtttggcacgatcgacgaaacggaggatcc
tcgattgatctcgatgcaccagaagatgttttgatgggggttgtgatcaatgttccagtt
aaaaggtttgctgggatttggaaaagtagacattggattgctttgaggaagattgatggt
gtttggtataatttggatagtgacctttctgcccctcaatgttttcgtgataccgaaaaa
gtaagagagttcttggattttagtattgttcatggtggtgaggttttgcttgtcatgaat
cataaacagtcttaa

DBGET integrated database retrieval system