KEGG   Cicer arietinum (chickpea): 101497901Help
Entry
101497901         CDS       T02819                                 

Definition
phosphoenolpyruvate carboxylase-like
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Pyruvate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
C4-dicarboxylic acid cycle, NAD - malic enzyme type
C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101497901
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    101497901
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101497901
Enzymes [BR:cam01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     101497901
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca1
AA seq 966 aa AA seqDB search
MTNKMEKMASIDAQLRQLAPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEVY
ELSAEYERNYDPKKLEELGNLITSLDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNKL
KKGDFVDENNATTESDIEETLKKLVFKMKKTPQEVFDALKNQTVDLVLTAHPTQSVRRSL
LQKHARVRNCLSQLYAKDITPDDKQELDEALQREIQAAFRTDEIKRTPXXXXXXXXXGMS
YFHETIWKGVPIFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRD
VCLLARMMAANLYYSQIEDLMFELSMWRCNDELRVRAEALHSHSKKDEVAKHYIEFWKKI
PLNEPYRVILGDVRDKLYRTRERSRYLLAHGYSDIPEEATFTNVDEFLEPLELCYRSLCA
CGDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVMDAITKHLGIGSYQEWSEEK
RQEWLLSELSGKRPLFGPDLPQTEEIQDVLETFRVIAELPSDNFGAYIISMATAPSDVLA
VELLQRECHIKNPLRVVPLFEKLDDLEAAPAALARLFSVEWYRNRIDGKQEVMIGYSDSG
KDAGRFSAAWQLYKAQEELRNVAQKFGIKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIH
GSLRVTVQGEVIEQSFGEQHLCFRTLQRFTAATLEHGMRPPSSPKPEWRALMDQMAVIAT
EEYRSIVFKEPRFVEYFRLATPEMEYGRMNIGSRPAKRRPSGGIETLRAIPWIFAWTQTR
FHLPVWLGFGAAFKQVIEKDVKNLHMLQEMYNKWPFFRVTIDLVEMVFAKGDPGIAALND
RLLVSQDLWPFGEQLRNKYEETKKLLLQVAAHKEVLEGDPYLKQRLRLRDSYITTLNVFQ
AYTLKRIRDPNYSVTVRPHISRESVETSKPADELVTLNPTSEFGPGLEDTLILTMKGIAA
GMQNTG
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacaaaatggaaaaaatggcttccattgatgctcagcttaggcaattagcacca
gcaaaagtgagtgaagatgataaacttattgagtatgatgctttgttgttggatcggttt
cttgatattcttcaggatttacatggagaggatctcaaggaaactgttcaagaagtgtat
gagctttctgccgagtatgaaagaaactatgatcctaagaaacttgaagaacttggaaac
ttgataacaagtttagatgcaggagactcaattgttgttgcaaagtccttttcacacatg
cttaacttggcaaacttagctgaagaggttcagattgctcaccgccgaaggaacaagttg
aagaaaggtgattttgtggacgagaacaatgcaactacagaatcggacatcgaagaaact
ctcaagaaacttgtatttaaaatgaagaaaactcctcaggaagtttttgatgcattgaag
aaccagacggttgatctggttcttactgctcatcctactcagtccgttaggagatctttg
cttcaaaagcatgcaagggtaaggaactgtttatctcaattgtatgcaaaagatatcact
cctgatgataaacaggagcttgatgaagctcttcagagagagattcaagccgcattccgt
acagatgaaatcaagaggacaccnnnnnnnnnnnnnnnnnnnnnnnnnnnnggaatgagc
tacttccatgaaacaatttggaagggtgttcctatatttctgcgccgtgttgatacagcg
ttgaagaacatagggattaacgaacgtgttccctataacgctcctcttattcagttttct
tcttggatggggggtgatcgtgatggtaatccgagagttactccagaagtgacaagggat
gtttgcctactagctagaatgatggctgctaatttgtattattcacagattgaagatctt
atgtttgaactttctatgtggcgttgcaatgatgagctacgtgttcgtgcagaagcactt
cacagtcattccaagaaagacgaagttgcaaaacattatatagaattttggaaaaaaatt
cctttaaatgaaccataccgtgttatacttggtgatgtaagggataagctctaccgtact
cgtgagcgttctcgttatctgctagctcatggatattctgatattccagaagaagccact
ttcaccaatgttgatgagttcctggaacctcttgaactctgctatagatcactctgcgct
tgtggtgatcgtgcaatagccgatggaagccttcttgatttcttgaggcaggtttcaact
tttggactgtcactggtaaggcttgatataaggcaagagtcagatcgtcacactgatgtt
atggatgcgattaccaaacatttgggaattggatcctaccaagaatggtctgaagagaaa
agacaagaatggcttttgtctgagttgagtgggaaaaggccattgtttggtcccgacctt
cctcaaaccgaagaaattcaagatgtcttggagacatttcgtgtcatagcagaattacca
tcagacaactttggagcctatatcatatctatggcaactgcaccatctgatgtgcttgcg
gtcgaacttcttcaacgcgaatgccacatcaagaatccgttaagagttgtaccgttgttt
gagaagcttgatgatcttgaggctgctcctgctgcgttggctcggctgttctcagtagaa
tggtacagaaaccggatcgatggtaagcaagaagtcatgattggatattcggattcagga
aaagacgccggaaggttttctgcagcatggcagctatataaggctcaagaggaactcaga
aatgttgctcagaaattcggtattaagctaaccatgttccacggtcgtggtggaacagtt
ggaagaggaggtggacctactcatcttgctatcttgtctcaacctccagacacgattcat
ggatcgcttcgtgtgacggttcaaggtgaagttattgaacagtcatttggagagcagcac
ttgtgctttagaacgctgcaacgtttcactgctgccactctagaacatggaatgcgtccc
ccaagttctccaaaaccagaatggcgtgccttgatggatcaaatggctgtcattgctacc
gaagaataccgttcaatagtgttcaaggagccgcgttttgttgagtatttccgcctggct
acaccagagatggagtatggaaggatgaacattggaagccgaccggcaaagagaaggcct
agtggaggaatcgaaacactgcgtgcgataccgtggatctttgcatggacacaaacaagg
tttcatcttccagtatggctaggatttggagcagcatttaaacaagttattgagaaggat
gttaagaatcttcatatgctgcaagagatgtacaataaatggcctttctttagggtcaca
attgatttagttgaaatggtgtttgccaaaggagaccctggaattgcagctttgaatgat
aggctcctagtttcacaggatctgtggccatttggtgagcagttgaggaacaaatatgaa
gaaactaagaaactcctacttcaggtggctgcacacaaggaagttcttgaaggagaccct
tacttgaagcaaagactcaggcttcgtgattcgtacatcacaactctcaacgttttccaa
gcttacacattgaaaaggatccgcgatccaaactacagcgtgacggtgcgccctcacatt
tcaagagagtccgtggaaacaagtaaaccagccgatgaacttgtaacactgaatccaaca
agtgaatttggtcctggattggaagacacactcattcttaccatgaagggtattgctgct
ggaatgcagaacactggttaa

DBGET integrated database retrieval system