KEGG   Cicer arietinum (chickpea): 101498629Help
Entry
101498629         CDS       T02819                                 

Definition
thymidine kinase-like
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cam00240]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca5
AA seq 226 aa AA seqDB search
MASSLVSSSVRDSSHSSSGEIHLFVGPMFAGKTTSLLRRIKSEADSGRNVAMLKSSKDNR
YAIDSVVTHDGIKFPCWALPDLMLFKDKYGHEAYEKLDVIGIDEAQFFEDLYDFCCKAAD
EDGKIVIVAGLDGDYLRRSFGSVLHIIPIADTVTKLTARCELCGKRAFFTLRKTEETQTE
LIGGADLYMPVCRRHYVSGQVVEAAKSVLESQNVKSDSLLEGTSVV
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttccttagtcagtagcagtgtcagagactcttctcactcatcatctggcgag
atccatctctttgtgggtcccatgttcgctggtaaaacgacctcccttcttcgtcgtatt
aagtctgaggctgacagcggcaggaatgtggcaatgttaaaatcaagcaaggataataga
tatgcaattgactctgttgtgactcacgacgggatcaaatttccttgctgggcattacca
gatttgatgttgttcaaagataaatatggccacgaggcttatgaaaagttggatgtgatt
ggtatagacgaggctcaattttttgaggacttgtatgatttttgctgcaaggctgctgat
gaagatggtaaaattgtgattgttgcaggcctggacggtgattacttaaggagaagcttt
ggctcagtgcttcatataataccgattgctgatacagttactaagttgacagctcgctgt
gaactgtgtggtaaacgggctttctttactttgaggaagacggaagaaacacaaactgaa
ctaattggtggggccgatttatacatgccggtgtgccgccgtcactatgtgagcggtcaa
gttgtggaagctgccaagagtgttttggaatctcaaaatgttaaaagtgattctcttctt
gagggaacttcagttgtttaa

DBGET integrated database retrieval system