KEGG   Cicer arietinum (chickpea): 101498629Help
Entry
101498629         CDS       T02819                                 

Definition
thymidine kinase-like
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    101498629
Enzymes [BR:cam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     101498629
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca5
AA seq 226 aa AA seqDB search
MASSLVSSSVRDSSHSSSGEIHLFVGPMFAGKTTSLLRRIKSEADSGRNVAMLKSSKDNR
YAIDSVVTHDGIKFPCWALPDLMLFKDKYGHEAYEKLDVIGIDEAQFFEDLYDFCCKAAD
EDGKIVIVAGLDGDYLRRSFGSVLHIIPIADTVTKLTARCELCGKRAFFTLRKTEETQTE
LIGGADLYMPVCRRHYVSGQVVEAAKSVLESQNVKSDSLLEGTSVV
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttccttagtcagtagcagtgtcagagactcttctcactcatcatctggcgag
atccatctctttgtgggtcccatgttcgctggtaaaacgacctcccttcttcgtcgtatt
aagtctgaggctgacagcggcaggaatgtggcaatgttaaaatcaagcaaggataataga
tatgcaattgactctgttgtgactcacgacgggatcaaatttccttgctgggcattacca
gatttgatgttgttcaaagataaatatggccacgaggcttatgaaaagttggatgtgatt
ggtatagacgaggctcaattttttgaggacttgtatgatttttgctgcaaggctgctgat
gaagatggtaaaattgtgattgttgcaggcctggacggtgattacttaaggagaagcttt
ggctcagtgcttcatataataccgattgctgatacagttactaagttgacagctcgctgt
gaactgtgtggtaaacgggctttctttactttgaggaagacggaagaaacacaaactgaa
ctaattggtggggccgatttatacatgccggtgtgccgccgtcactatgtgagcggtcaa
gttgtggaagctgccaagagtgttttggaatctcaaaatgttaaaagtgattctcttctt
gagggaacttcagttgtttaa

DBGET integrated database retrieval system