KEGG   Cicer arietinum (chickpea): 101498663Help
Entry
101498663         CDS       T02819                                 

Definition
glutamate dehydrogenase A-like
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:cam00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cam00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cam00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca7
AA seq 411 aa AA seqDB search
MNALAATNCNFQRAARILGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYVGFRIQHDN
ARGPMKGGIRYHPEVDPDEVNALAQLMTWKTAVADIPYGGAKGGIGCNPRDLSISELERL
TRVFTQKIHDLIGIQRDVPAPDMGTNAQTMAWILDEYSKFHGHSPAVVTGKPIDLGGSLG
REAATGLGVVFATEAWLAENGKSIAENTFVIQGFGNVGTWAAKSLYERGGKVVVVSDITG
AIRNPNGIDIPALLKHKETNGNLTEFQGADVMDPNEVLVHECDVLIPCALGGVLNKENAA
DVKAKLIVEAANHPTDPEADEILAKKGVTILPDIYANAGGVTVSYFEWVQNIQGFMWDEE
KVNRELKKYMSKAFLDIKAMCKSNNCDLRMGAFTLGVNRVARATLLRGWEA
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctctagcagccacaaactgcaattttcaacgtgctgctcgtattctaggcttg
gattccaagcttgagaagagtcttctcatacccttcagagaaatcaaagttgaatgtacg
atccccaaagatgatggaactctggtttcttatgtggggtttaggatccaacatgacaat
gctcgtggtcctatgaaaggagggattcgttatcaccctgaggttgaccctgatgaggtg
aatgctctagctcagctgatgacatggaagacagctgtagcagacatcccctacggagga
gcaaagggtggaattggctgcaacccaagggacctgagcatcagtgagttagaacgtcta
actcgggttttcacccaaaagattcatgatctcattggtattcagcgggatgttcctgcc
cctgatatgggaaccaatgctcagactatggcatggattctcgacgagtattcaaagttt
cacggtcattcaccagctgttgtgaccggaaagccaattgatcttggaggttctttggga
agggaggcagccacaggtctcggagttgtttttgcaactgaggcttggttagctgaaaat
gggaagtcaattgctgagaacacatttgtcattcagggctttggaaacgtgggaacctgg
gccgctaagtctctttatgagagaggtggtaaggttgttgttgtgagtgacatcactggt
gccatccgaaatcccaatggaatcgacatccctgcccttctgaaacacaaggaaaccaac
ggaaacttgaccgagttccaaggagcagatgtaatggatccaaatgaagtgcttgttcat
gaatgtgatgttcttatcccatgtgccttgggtggagtactgaacaaggaaaatgctgct
gatgtgaaagctaaacttatagttgaagctgcaaatcacccaactgaccctgaagcggat
gagattttggccaaaaaaggagtcactatattacctgatatttatgctaatgctggtgga
gttactgtgagctactttgaatgggttcagaacattcaaggtttcatgtgggatgaagaa
aaagtgaaccgtgagctgaagaagtacatgagcaaggctttcctagacatcaaagcaatg
tgcaaatccaacaattgtgacctgagaatgggagccttcactctgggagtgaaccgtgtt
gcccgcgctactcttttgagaggttgggaagcttaa

DBGET integrated database retrieval system