KEGG   Cicer arietinum (chickpea): 101499067Help
Entry
101499067         CDS       T02819                                 

Definition
choline/ethanolamine kinase-like
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101499067
Enzymes [BR:cam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     101499067
    2.7.1.82  ethanolamine kinase
     101499067
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca5
AA seq 659 aa AA seqDB search
MGAGEDLVNNAANAAENPVNDATGTTENSITNTGDSSENAENAVDVENHTKDQINVAENP
TYDQAGCAANPRNDQKCSEEYPAKDDAGDDSTKDQVGGAENPVDDQEGDAENPLNDTAGG
TEDIVNDKTGGAETETPINDQLNVAENPANDQAGGAANLVNEQACSAEYRVKEEAGDDST
KDQEGGAENSVNDTSGGSDNFMNNEAHAAENSTNDIAGDYETENSMNDKTGDDEIPVNNN
DNAVENSFDDEQDDAENLVDTIDTLSNSEDDDVETPVSSKIDRLPEEAQEILISMAGKWE
DVLDASALQVIPLKGAMTNEVFQIKWPATTGENSRKVLVRIYGEGVDIFFDRDDEIRTFE
YMSKNGQGPRLLGRFTNGRVEEFIHARTLSASDLRDPSISALIAAKMKEFHDLAMPGEKK
VNLWRTLRTWLSEAKRLSSPKEVEAFYLDTVDKEISILEKELSGAHQRIGFCHNDLQYGN
IMLDEETNSVTIIDYEYASYNPVAYDIANHFCEMAANYHTKMPHILDYNKYPDFQERELF
IRAYLWSSGEQPSVSEVEHLLQEVEKYTLANHLFWGLWGIISGQVNTIEFDYKEYAKQRF
QEYWARKPYLLSSDAPSPFNVPEGTGELASVVHARGTKNTGIFRKMKRVLGVGLFRSKS
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcaggtgaagatcttgtaaacaatgcagctaatgctgctgagaatcctgtaaac
gatgccactggtactacagaaaactctataactaatacaggagattcttcggaaaatgct
gaaaacgctgttgatgtggaaaaccatacaaaggaccaaataaatgttgcagaaaatcct
acatatgaccaagcaggttgtgcagcaaacccgagaaatgaccaaaaatgtagtgaagaa
tatccagcaaaggacgatgcaggtgacgattctacaaaggaccaagtaggtggtgcagaa
aatcctgtagacgatcaagaaggtgatgcagaaaatcctttaaatgacacagcaggtggt
acggaagatatagtaaatgataaaacaggtggtgcagaaacagaaactcctataaatgac
caattaaatgttgcagaaaatcctgcgaatgaccaagcaggtggtgcagcaaatctggtg
aatgagcaagcatgtagtgcagaatatcgagtaaaggaagaagcaggtgatgattctaca
aaggaccaagaaggtggtgcagaaaattctgtaaatgacacatcaggtggttcagacaat
tttatgaataatgaagcacatgctgctgaaaattccacaaatgatatagcaggtgattat
gaaacagaaaactccatgaatgacaaaacaggtgatgatgaaatacctgtaaacaacaac
gacaatgctgtagaaaattcttttgacgacgaacaagatgatgcagaaaatcttgtagat
accattgatacactgtcaaacagcgaagatgatgatgttgaaacccctgtaagcagcaaa
atagaccgccttccagaagaagcacaggagatactgatatcaatggcaggtaaatgggag
gatgtactagatgcaagtgcattgcaggtgatccctctcaagggggctatgacaaatgag
gtattccaaataaagtggccagctacaactggggaaaactcacggaaggttctagttaga
atctatggtgagggtgtggacattttctttgatagggatgatgaaatacgaacctttgag
tacatgtcaaagaatggtcagggacctcgtctactgggacgttttacaaatggacgcgtt
gaagagtttatccatgcacggacattgtcagcttctgatctacgtgatccatctatttct
gctcttatagcggccaaaatgaaggagtttcatgatctagctatgcctggtgaaaagaaa
gtcaatctttggcgcacattgagaacttggcttagtgaggccaaacgtttgtcttctcca
aaggaagtcgaagctttttatttggatacagtggacaaggaaatctctattttggaaaag
gaactatcaggagcacatcaacggataggattttgccacaatgatttacaatatggtaac
ataatgcttgatgaagagaccaattctgtgaccataatagattatgaatatgcaagttac
aatcctgtagcgtatgatatagcaaaccacttctgtgagatggctgcaaactatcataca
aaaatgcctcatattcttgattacaacaaatatcctgattttcaggagcgtgaactattt
attagggcatatttgtggtcctcaggtgaacaaccaagtgtgagtgaagtggagcatctc
cttcaagaagttgagaagtatacacttgcaaatcatctattctggggactttggggaata
atttcgggacaagtaaacacaattgagtttgactacaaggaatatgcaaaacagaggttt
caagaatattgggcaaggaaaccatatcttctgagctctgatgcaccttctccttttaat
gtccctgagggtacaggagaacttgcttcggtagtgcacgccagaggaacgaagaacact
ggtatcttcaggaagatgaagagagttttgggtgttggcttgttcaggtcgaaaagctaa

DBGET integrated database retrieval system