KEGG   Cicer arietinum (chickpea): 101499361Help
Entry
101499361         CDS       T02819                                 

Definition
(RefSeq) protoporphyrinogen oxidase, chloroplastic/mitochondrial
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00860  Porphyrin and chlorophyll metabolism
cam01100  Metabolic pathways
cam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    101499361
Enzymes [BR:cam01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     101499361
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     101499361
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_binding_2 DAO Pyr_redox_2 FAD_oxidored Thi4 HI0933_like Pyr_redox AlaDh_PNT_C FMO-like FAD_binding_3 GIDA IlvN NAD_binding_9 3HCDH_N Pyr_redox_3 HDPD ApbA NAD_binding_7
Motif
Other DBs
NCBI-GeneID: 101499361
NCBI-ProteinID: XP_004515432
UniProt: A0A1S2Z5I8
Position
Un
AA seq 502 aa AA seqDB search
MASSAKDNNSRSVKRVAVVGAGVSGLAAAYKLKSHGLDVTVFEAEGRAGGRLRTVSRDGL
VWDEGANTMTENEAEVKSLIDALGLQEKQQYPLSQHKRYIVKNGMPLLVPANPAALLKSK
LLSAQSKIRVIFEPFMWKRSDSSTVCDENSEESVSRFFERHFGKEVVDYLIDPFVGGTSA
ADPESLSMRHSFPELWNLEKRFGSIIGGALQSNLFGKRDKTGETKDAPRKSKHQRGSFSF
QGGMQTLTDTLCKELGKDNLKLNAKVLTLAYSHNGSSPSENWSITCASNLTTQDVDAVIM
TAPLGNVKDIQITKRGTPFTLNFFPEVTYLPLSVLITTFKKENVKRPLEGFGVLVPSKEE
QNGFKTLGTLFSSMMFPDRAPSDLHLYTTFIGGTRNRELAQASTDELKKIVTSDLRKLLG
AEGEPTFVNHFYWSKGFPLYGHNYGLVLEAIDKMEKGLPGFFYAGNHRGGLSVGRAIASG
CKAADLVISYLNNASDNTVADK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctctgcaaaagataataactcaagatctgttaaaagagttgctgttgttggt
gctggtgtaagtgggcttgctgcggcttacaaattgaaatcacatgggctagatgtaact
gtgtttgaagctgaaggaagagctggagggaggttaagaactgtttctcgagatgggcta
gtttgggacgagggagctaatacaatgactgaaaatgaagcagaggttaaaagcttgatt
gatgctcttggacttcaagaaaaacaacaatatccattgtcacagcataagcgctatatt
gtgaaaaatgggatgccacttctggtacccgcaaatcctgctgcactactgaagagcaaa
ctgctttctgcacaatcaaagattcgcgtcatttttgaaccatttatgtggaaaagaagt
gactcctctaccgtgtgtgatgaaaattctgaagaaagtgttagcagattctttgaacgt
cattttgggaaagaggttgtggactatctcattgatccttttgttggcggtacaagtgca
gcagatcctgaatctctttctatgcgccattctttcccagagctatggaatttggagaaa
aggtttggctccattataggtggggctttacaatccaacttatttggcaaaagggacaaa
acaggagaaactaaagatgcaccgagaaaaagcaagcaccagcgtggttcattttctttt
cagggcgggatgcagacattgactgatacgttgtgcaaagagcttggcaaagacaacctt
aaattaaatgcaaaggttttgacactagcttacagtcataatggaagttctccatcggaa
aattggtctattacttgtgcttctaacctaacaacacaagatgttgatgcagtaattatg
acggctcctctaggtaatgtcaaagacatccagatcacaaaaaggggaacccccttcaca
cttaatttttttcctgaggtgacctatttgccactctcagtcttaattaccacctttaaa
aaggagaatgtgaagagacctctagaaggatttggagttcttgttccttcaaaagaggaa
caaaatggttttaaaacccttggtacacttttttcctctatgatgtttccagatcgggct
cccagtgatttgcatctctatactaccttcatagggggaactcgaaacagggaactcgct
caagcgtcaactgacgagctcaagaaaattgtcacttctgacctgagaaagttgttggga
gcagaaggggagcccacatttgtcaaccatttctactggagtaaaggctttcctttgtat
ggtcataactatggattagttcttgaagcaattgacaagatggaaaaaggtcttcccgga
tttttctatgcaggtaaccacagaggtggactctcagttggcagagcgatagcctcaggt
tgcaaagcagctgatcttgtaatttcctacctcaacaatgcttcagacaatacagtggct
gataaatga

DBGET integrated database retrieval system