KEGG   Cicer arietinum (chickpea): 101499388Help
Entry
101499388         CDS       T02819                                 

Definition
endoglucanase 16-like
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101499388
Enzymes [BR:cam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     101499388
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca5
AA seq 484 aa AA seqDB search
MGIERLYWAIIVAWLTLFQGNMIIFVKGEFNYKEALTKSLIFLEAQRSGKLPPNNRVPWR
GDSALDDGKLANVDLAGGYYDAGDNVKYGLPMAFTVTTLSWAAIFYKSEFEATKELGNIQ
DAIKWGTDYFIKASSRRQRLYVQVGDAEEDHHCWAPPELMKTKRSVLQIDSNTPGTEIAT
ETSAAMAASSIVFRHVDKKYARQLLNKAKLLFDMAKSHKGTYDGECPFYCSYSGYNDELM
WAATWLYMATRKQVYMKYIQEEAISASVAEFSWDLKYAGVQVLLTQLHFEGQKNLETFKT
HGESFICSVLPDSPYHQINLSPGGFIHLRDGANTQYATSTAFLFTVYSDLLAKYKQKITC
GSKQFSSSDLLAFAKKQMDYILGKNPEGRSYMVGFGNNPPTQAHHRGASVPKLPPNEEIN
CALSFSKWLQRDAPNPHELTGAIVGGPDCKDKFDDKRTDSPKTEPCTYVNSLAAGALAKL
ASLG
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgggtattgaaagattatattgggccatcattgtagcatggcttactttgttccaagga
aacatgataatatttgttaagggtgaatttaattataaagaggctctcacaaaatccctt
attttcttagaggcacaaagatcaggaaaactccctcccaataatagggttccttggaga
ggagactcagcactagacgacggaaaacttgctaatgtggacctagctggtggatattat
gatgcaggggataatgtgaaatatggattaccaatggctttcactgttactacattatca
tgggctgcaattttttacaaatcagaatttgaagcaacaaaggaactaggaaatattcaa
gatgcaattaaatggggtacagattattttataaaagctagttctagaagacagagatta
tatgttcaagtaggagatgcagaagaagatcatcattgttgggctccaccagaacttatg
aaaacaaaaaggtctgttttgcaaattgatagtaacacacctggaactgaaattgcaact
gaaacctcggctgcaatggctgcttcttccattgtttttcgacacgtcgataaaaaatat
gctcgtcaactcctcaacaaagcaaaattgcttttcgatatggcgaaatcgcataaagga
acttatgatggagaatgtcccttctactgctcttattcgggctacaatgatgaattgatg
tgggcagcaacatggctatacatggcaacaaggaaacaagtgtacatgaaatacatacaa
gaagaagcaattagtgcaagtgtagctgaattcagttgggatctaaaatatgctggagtt
caagtccttcttactcagttacattttgaaggtcaaaaaaatcttgaaacattcaaaacc
catggtgaaagtttcatatgctctgtccttcctgatagtccttaccaccaaattaatttg
tctcctggtgggtttattcatttgagagatggagccaacacacaatatgccactagcaca
gctttcttattcactgtatatagtgatttgcttgccaaatataaacagaaaatcacatgt
ggaagcaaacaattttcctcatctgatctccttgcctttgctaagaaacaaatggattac
atattggggaaaaatccagaaggaagatcatacatggtaggatttggaaacaacccacca
acacaagctcaccatagaggtgcttcagtgccaaagttaccaccaaatgaagagataaac
tgtgcattgagcttttcaaaatggcttcaaagagacgcaccaaacccacatgaactaact
ggagccattgttggtggacctgactgcaaagacaagttcgatgataaacgtacggattca
cctaagactgaaccttgtacatatgttaactcccttgcagctggagctctagcaaaactt
gcttctttgggttaa

DBGET integrated database retrieval system