KEGG   Cicer arietinum (chickpea): 101500626Help
Entry
101500626         CDS       T02819                                 

Definition
4-alpha-glucanotransferase DPE2-like
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cam00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca3
AA seq 977 aa AA seqDB search
MVNPGLSTGNKLVNSVKISFRLPYLTQWGQSLLVCGSVPVLGSWNVKKGVLLSPFHEGSE
LIWSGSITVPKGFQCEYTYYVVDDKKNVVRWEMGKKHELRLPEGVQSGQEIEFRDLWQTG
SDALPFRSAFRDVIFRQSWDSTIKTGVNHINVEPEAESILVQFKVFCPNIEKDTSIYVIG
SNTKLGHWKVQHGLKLSYFGEFVWLAECVMQRSDFPIKYRYCKYGRSGNASIENGPNREV
SINSSRREAKYIYLSDGMIRETPWRGAGVAIPMFSIRSESDLGVGEFLDLKLLVDWAVAS
GFHLVQLLPINDTSVHRMWWDSYPYSSLSVFALHPLYLRVQALSENIPEEIKQEIEKAKQ
QLDGKDVDYEATMATKLSIAKKVFDQEKDLILNSSSFHEFFSENEGWLKPYAAFCFLRDF
FETSERSEWGRFAHYSEDKLEKLVSKESLHYGIICFHYYVQYHLHLQLSEASEYARKKGV
ILKGDLPIGVDRNSVDTWVYPNLFRMNTSTGAPPDYFDKNGQNWGFPTYNWEEMSKDNYA
WWRARLTQMGKYFTAYRIDHILGFFRIWELPDHAVTGLVGKFRPSIPLSQEELEREGIWD
FNRLSRPYIRQEILQQKFGLAWTFVATTFLNEYEKNCYEFKEDSNTEKKIVSKLKTSAES
SLLLDGEDKIRRSLFDLLQNIVLIRDPEDPKSFYPRFNLEDTSSFQALDDHSKNVLKRLY
YDYYFHRQETLWRQNALKTLPALLNSSDMLACGEDLGLIPSCVHPVMQELGLVGLRIQRM
PNESDLEFGIPSQYSYMTVCAPSCHDCSTLRAWWEEDDERRQRFFKNVMESNELPPDQCV
PEIAHFIIRQHIESPSMWAIFPLQDLLALKEEYTARPATEETINDPTNPKHYWRFRVHVT
LESLNEDNKLKTIIKDLVRWGGRSIPSEDSQVESSLISASSVADDVSKKQQFAGTGEKIR
HPSEFNGVPTKDPLAVL
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
atggtgaatccgggcttgtctactggaaacaagttggtgaattcagtgaagataagcttt
cggttaccgtatcttacacaatggggtcagagcttattggtgtgtggctctgtaccagtt
cttggatcctggaatgtgaagaagggtgtgttgctcagtccctttcatgaaggttctgag
ctcatttggagtggaagcattacagtgccaaaagggtttcaatgcgagtacacctattat
gttgtggatgataagaaaaatgttgtgagatgggagatggggaagaagcacgaactgagg
ctccccgaaggtgttcagagtggtcaggaaatcgagtttcgtgatctttggcagactggc
tcagatgctctccctttcagaagtgctttcagagatgtcatttttcggcaaagctgggat
tcgaccatcaagacaggagtcaaccacatcaatgttgaaccagaagcagaatccatcctc
gtccagttcaaagttttctgcccaaatattgagaaagatacatcaatatacgtgataggt
agcaacacaaagttgggacattggaaagttcaacacggactaaaactaagctattttggt
gaatttgtctggctagctgaatgtgtgatgcaaaggagtgactttccaattaaatataga
tattgtaaatatggcaggtctgggaatgcgtctatcgaaaatggtccaaatcgagaagtc
tccatcaactcctcaagaagagaggcaaaatatatttatctttcagacggcatgattcgt
gaaacaccgtggcgcggtgccggtgtagcaattcctatgttctctattaggtcggaatct
gatctaggtgttggcgagtttcttgaccttaaattactagttgactgggctgtagcatct
ggtttccatttagttcaacttttaccaatcaatgatacatccgtgcatcggatgtggtgg
gattcttatccatacagttcactatcagtatttgcgctgcatccgttgtacctgagagta
caggcactttctgagaacataccagaggagatcaagcaagagattgagaaggcaaaacaa
caattagatgggaaggatgttgattatgaagctacaatggctactaaactctcaattgct
aagaaagtttttgatcaagagaaggatttaatccttaattcgagttcctttcatgagttc
ttttctgagaacgagggttggttgaaaccctatgctgcattctgtttcctgcgagatttc
tttgaaacatcagaacgaagtgaatggggccgttttgctcattattcagaagataagtta
gagaaacttgtatcaaaggaaagtctgcattacgggataatttgcttccactactatgtt
caataccatctacatctacaattgtctgaagcttcagaatatgcgagaaagaaaggagtg
attctaaagggagatcttcccattggagttgacagaaacagcgtggatacatgggtttat
ccaaatttgttccgaatgaacacttctaccggggcacctcctgattattttgataaaaat
ggccagaattggggctttcctacttataattgggaagagatgtcgaaagacaactatgct
tggtggcgagctcgattgacacagatgggaaagtatttcacagcttacaggattgatcac
atattgggatttttccgaatttgggaacttccagatcacgctgtgactggtctagtcgga
aaattccgaccatctattccgctaagtcaggaagaacttgaaagagaaggaatatgggat
tttaatcgcctgagccgcccatacattaggcaggaaatattacagcaaaaatttggattg
gcgtggacgtttgttgcaacaacttttctgaatgaatatgaaaagaactgctatgagttc
aaggaggatagcaacaccgagaaaaaaattgtttccaaactgaaaacttccgcagaaagt
tccctgttgttggatggtgaagacaaaatccgacgcagtctgttcgatcttttacagaat
atagttctaatccgagatccggaggatccaaaaagtttttatcctcgtttcaaccttgaa
gatacctcaagttttcaagctttggatgatcatagcaagaatgttctgaaaagattatat
tacgactactatttccatcgtcaagagactctttggagacaaaatgcactgaagactcta
cctgcacttctaaattcatcagacatgctggcctgcggggaagatttgggcctcattcca
tcttgcgtgcatcctgttatgcaagagctcggattagtggggttgcgcattcaacggatg
cccaatgaatccgatctggaattcggtattccttctcaatacagctacatgacggtatgt
gccccatcatgtcatgactgttccaccttgcgtgcttggtgggaagaagacgatgaaaga
agacaacggtttttcaagaatgtgatggagtcaaatgagttgccacctgatcaatgtgtt
ccagaaattgcacattttattataaggcaacatattgaatccccatcaatgtgggcaatt
ttccctcttcaggacttgttagcattaaaagaagaatatacagcacgccccgcaacggaa
gagacaatcaacgaccctacaaatccgaagcactattggagattccgtgtgcatgtgact
ctggagtcattgaatgaagataataagctcaaaaccataatcaaagatcttgtacgttgg
ggtggaagatcaattccttcagaggactcacaagttgaatcaagtctaatctcagcatca
tcagtagcagatgatgtctccaagaagcaacagtttgccggtaccggtgaaaagatccgt
catccttctgagtttaacggagttccaacaaaggatcccttggctgtcctttga

DBGET integrated database retrieval system