KEGG   Cicer arietinum (chickpea): 101500746Help
Entry
101500746         CDS       T02819                                 

Definition
chalcone--flavonone isomerase 1-like
Orthology
K01859  
chalcone isomerase [EC:5.5.1.6]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    101500746
Enzymes [BR:cam01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.6  chalcone isomerase
     101500746
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca4
AA seq 224 aa AA seqDB search
MTTAASITGMKVEFLEFPPVVTSPATAKSYFLGGAGERGLTIEGNFIKFTAIGVYLEDIA
VASLATKWKGKTSQQLLQTLDFYRDIISGPFEKLIRGSKIRELSGPEYSRKVMENCVAHL
KSIGTYGDEEVEAMQKFAEAFKNVNFPPGASVFYRQSPDGVLGLSFSKDASIPEKEDAVI
ENKAVSSAVLETMIGEHAVSPDLKRCLAARLPALFDQGTFSIGN
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgacgacggcagcatccatcactgggatgaaggttgagtttcttgaatttccgccggtg
gtcacatctccggcaaccgccaagtcctatttcctcggtggcgcaggggagagaggtttg
actattgagggtaacttcatcaagttcactgccattggagtctatttagaagacatagca
gtggcttcacttgccactaaatggaagggtaaaacctctcaacagttgctccagaccctt
gatttctacagagacatcatttcaggcccatttgaaaagttaattcgagggtctaagatt
cgggaactgagtggtcctgagtactcaaggaaggtaatggagaattgtgtggcacacttg
aaatctattggaacttatggcgatgaagaagttgaagctatgcaaaaatttgctgaagcc
ttcaagaatgtgaattttccacctggtgcctctgttttttataggcaatcacctgatgga
gtattagggcttagtttctctaaagatgcaagtatcccagaaaaggaggatgcagttatt
gagaacaaggcagtttcatcggcagtgttggagactatgattggtgaacatgctgtttct
cctgatttaaagcgctgtttggctgcaagattacctgctttgttcgaccagggtactttt
agtattggaaattga

DBGET integrated database retrieval system