KEGG   Cicer arietinum (chickpea): 101501037Help
Entry
101501037         CDS       T02819                                 

Definition
1,4-alpha-glucan-branching enzyme 2-1, chloroplastic/amyloplastic-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cam00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca3
AA seq 885 aa AA seqDB search
MVYTISGIRFPVVPSLHKSSLRGDRRTSSYSLFLKKSNSFSRTSLYAKFSHDSESKSSTI
AESDKVLIPEDQDISASVKDQLETPEIISEDAQSFQKLEDLTMKDENKYNLDEAASSYRE
VGDGQGSVMSSSPVDVNTNAQANKTSVHSGEKVKILSDEDKPKIIPPPGTGQKIYEIDSF
LKAHSQHLDFRYGQYKRIREEIDKYEGGLDAFSRGYEKLGFTRSATGITYREWAPGAKSA
ALVGDFNNWNPNADVMTRDDFGVWEIFLPNNADGSPPIPHGSRVKIHMNTPSGIKDSIPA
WIKFSVQAPGEIPYNGIYYDPPEEEKYVFKHPQPKRPQSIRIYESHVGMSSPEPKINTYA
NFRDDVLPRIKKLGYNAVQIMAIQEHSYYASFGYHVTNFFAPSSRFGTPEDLKSLIDRAH
ELGLLVLMDIVHSHASNNTLDGLNMFDGTDGHYFHPGSRGYHWMWDSRLFNYGSWEVLRY
LLSNARWWLDEYKFDGFRFDGVTSMMYTHHGLQVSFTGNYNEYFGFATDVDAVVYLMLVN
DLIHGLFPEAVTIGEDVSGMPTFCVPTQDGGIGFNYRLHMAIADKWIELLKKKDEDWRMG
DIVHTLTNRRWLEKCVAYAESHDQALVGDKTLAFWLMDKDMYDFMALDRPSTPLIDRGIA
LHKMIRLITMGLGGEGYLNFMGNEFGHPEWIDFPRGEQHLPNGVVVPGNNNSFDKCRRRF
DLGDAEYLRYHGMQEFDQAMQHLEESYGFMTSEHQYISRKNEGDKVIIFERDNLVFVFNF
HWTNSYSDYRVGCLMPGKYKIVLDSDDALFGGFNRINHTAEYFTSEGWYDDRPRSFLVYA
PCRTAVVYALVDGVDSEPVEQSVEVEQPVEVEQPVEIEQSVEVEP
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atggtttacaccatctcaggaattcgatttcccgttgttccttcactgcacaaatcaagc
ttacgtggcgatcgcaggacttcatcttactcactttttctcaagaagagtaactcattc
tctcgtacatcactttatgcaaaattttctcatgattctgaatccaaatcttccacaatt
gctgaatctgataaagtacttattcctgaagatcaagatatctctgcatccgtgaaggat
caacttgaaactcctgaaataatctcagaggatgcgcagtcttttcagaagttggaggat
ttaaccatgaaagatgagaataagtacaatcttgatgaagcagctagcagttatagagaa
gttggggatgggcaaggttctgttatgtcatcatcacctgtagacgttaacaccaatgct
caagccaataagacatcagttcattcaggcgagaaagttaaaatactaagtgatgaagat
aaacctaagatcattcctccacctggtactgggcagaaaatatatgagattgattcattt
ttgaaagctcacagtcagcatcttgatttccgttatggacagtacaaaagaattcgtgag
gaaattgacaagtatgaaggtggtcttgatgcattttctcgtgggtacgaaaagttaggc
ttcacgcgcagtgctacaggcattacttacagagagtgggcacctggagctaagtcagca
gcattagttggagatttcaacaattggaatccaaatgcagatgtaatgactcgggatgat
tttggtgtgtgggagattttcttgccaaacaacgccgatggttcaccaccaattcctcat
gggtctcgagtcaagatccacatgaatactccctctgggatcaaggactcaattcctgct
tggatcaaattctctgtacaggctccaggtgaaattccatataatggaatatactatgat
cccccagaggaggaaaaatatgtcttcaaacatccacagccaaagagaccacaatcaatt
agaatatacgagtcacatgttggaatgagtagcccggaaccaaaaattaacacatatgcc
aattttagagatgatgtactacctcgcattaaaaagcttggttataatgctgtccaaatt
atggctatccaagaacattcttactatgctagctttgggtaccatgttactaatttcttt
gcacctagcagtcggttcggaacaccagaagatcttaagtctctgatagacagagcccac
gaactaggtctgcttgttctgatggatatagtacatagccatgcatcaaataatacattg
gatggcctgaacatgtttgatggaactgatggtcattacttccatcctgggtcacggggt
tatcattggatgtgggattctcgcctttttaactatggaagctgggaagttctaaggtat
ctactttcaaatgcaagatggtggctggatgaatataagtttgatgggtttcgatttgat
ggtgtcacatcaatgatgtacactcatcatgggctgcaggtatcttttactggaaactac
aacgagtattttggttttgcaactgatgttgatgctgtggtttacctgatgctggtaaac
gatctcattcatgggctcttccctgaggctgttacaattggtgaagatgtgagtggaatg
ccaacattctgtgttccgacgcaagatggtgggattggctttaactatcgcttgcatatg
gccattgcagacaagtggattgagcttctcaagaaaaaagatgaagactggagaatgggt
gatatagtccacacactaacaaacagaagatggctggaaaaatgtgtggcttatgctgaa
agtcatgaccaagccttggttggtgacaagacactagcattttggttgatggacaaggat
atgtatgacttcatggctttagacagaccatctactcctctaatagatcgtggtattgca
ttacacaaaatgattaggcttattactatgggccttggtggtgaagggtatttgaatttt
atgggaaatgaattcggccatcctgagtggattgattttccaaggggtgagcaacatctt
cctaatggcgtagtagttcccgggaataacaacagttttgataaatgtagacgtagattt
gacttgggggatgcagaatatctaagatatcatggaatgcaagaatttgatcaagctatg
cagcatctagaagaaagttatggtttcatgacttctgagcaccaatatatttcacggaaa
aatgaaggtgataaagttataatcttcgaaagggacaacctggtctttgtattcaatttt
cattggaccaacagttattcagattaccgagttggctgtttaatgccagggaaatataag
attgtcttggattcagatgatgccttgtttggtggcttcaataggatcaatcatactgct
gagtacttcacctctgaaggatggtatgatgaccggcctcgatctttcctcgtgtatgca
ccttgtagaacagcagtggtttatgcccttgtagatggagttgattcagagcccgttgaa
cagtcagttgaagttgaacagccagttgaagttgaacagccagttgaaattgaacagtca
gtcgaagttgaaccctga

DBGET integrated database retrieval system