KEGG   Cicer arietinum (chickpea): 101501370Help
Entry
101501370         CDS       T02819                                 

Definition
chalcone--flavonone isomerase 2-like
Orthology
K01859  
chalcone isomerase [EC:5.5.1.6]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavanone biosynthesis, phenylalanine => naringenin
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    101501370
Enzymes [BR:cam01000]
 5. Isomerases
  5.5  Intramolecular lyases
   5.5.1  Intramolecular lyases (only sub-subclass identified to date)
    5.5.1.6  chalcone isomerase
     101501370
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca4
AA seq 227 aa AA seqDB search
MASLPVTALEIENIVFPPTVKPPGSCDTLFLGGAGVRGLQIHDKFVKFTAIAIYLQYTSI
PFLADKWKGKSATELTETVPFFRDIVTGPFEKFMQVTMILPLTGQQYSEKVSENCVAIWK
SLGIYTDEEAKAIEKFLSVFKDQTFPSGSSILFTVSPKGAGSLTISFSKDGSIPEVESAV
IENKLLSEAVLESMIGAHGVSPAAKQSLASRLSELFKEGSDTSISPK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgcttcccgtaaccgctttggagatcgagaacatcgtattccctcccaccgtt
aagcctcctggatcctgcgacaccttattcctcggcggcgctggagtcaggggtcttcaa
atccatgacaaattcgttaaattcaccgctattgccatttatttgcagtatacatctatt
cccttcctcgccgataaatggaagggtaagtctgctactgaactaacggaaaccgtcccc
ttcttcagggatattgttacaggtccatttgagaaatttatgcaagtgacaatgatcttg
ccattgactgggcaacaatactcagagaaagtgtcagaaaattgtgtagctatttggaag
tctcttgggatttatactgatgaagaagccaaagcaatagagaaatttctttctgttttc
aaagatcaaacattcccatcgggctcttctatccttttcactgtatcacctaagggagca
ggatcattaacgataagtttctctaaagatggatccattccagaggttgagtctgcagtt
atagagaataaactactttcagaggctgtgcttgagtcaatgataggtgcacatggcgtc
tcccctgcagcaaaacagagtttggcctctagattatctgagttattcaaagagggttct
gatactagtatatcaccaaaatga

DBGET integrated database retrieval system