KEGG   Cicer arietinum (chickpea): 101502210Help
Entry
101502210         CDS       T02819                                 

Definition
histone acetyltransferase GCN5-like
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cam  Cicer arietinum (chickpea)
Brite
Enzymes [BR:cam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101502210
Transcription machinery [BR:cam03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101502210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca3
AA seq 541 aa AA seqDB search
MESHGGGPLRSRSSQSPSPSHSASASATSSIHKRKLASEDHAPPFPPSSLSADTRDGALT
SNDDLESISARGADSDSDDDSEDAVVDDDEDEYDNDNGSSMRNFTASRLNNAPSAPRNSK
LKAENSTVKIENSDVAKDAGPPVSGSTANAGSVPGIVVKEDATKIFTDNLQTSGAYSARE
ESLKKEEETGKLKFACLSNDGVDEHMVWLIGLKNIFARQLPNMPKEYIVRLVMDRSHKSV
MVIRRNNVVGGITYRPYASQKFGEIAFCAITADEQVKGYGTRLMNHLKQYARDIDGLTHF
LTYADNNAVGYFIKQGFTKEIHLEKDRWQGYIKDYDGGILMECKIDPKLPYTDLSTMIRR
QRQAIDEKIRELSNCHIVYAGIDFQKKEAGIPKKIVDDIPGLREAGWTPDQWGHSRFRTL
GGSTDTATNLKHLTAFMRSLLKSMHDHADAWPFKEPVDARDVPDYYDIIKDPMDLKTMSK
RVESEQYYVTFEMFVEDVRRMFANARTYNSPETIYYKCATRLEAHFQSKVTSVLQLGSKI
Q
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgcacggtggaggaccacttcgttcccgtagttcacagtccccttctccttcc
cactccgcttccgcctccgccacctcatccatccacaaacgcaaactcgcatctgaagat
cacgcgcctccgtttcccccttcttccttatccgccgacacacgcgacggcgccctaact
agcaatgatgatctcgaaagcatctccgcccgcggcgccgactctgattccgacgacgat
tcagaggacgcagtcgtcgatgacgatgaggatgaatacgacaatgacaatggctcctcc
atgcgcaatttcactgcttccaggctcaacaatgctccatccgctcctcgcaattccaag
ctcaaagctgaaaattccaccgttaagatcgagaattccgacgtcgctaaagacgccgga
cctccagtctccggctctaccgccaatgcaggctccgtccccgggattgtggttaaggaa
gacgctacaaagatattcactgataatttgcagacaagtggtgcttacagtgccagagaa
gagagtctcaaaaaagaggaagaaactgggaagctcaaatttgcatgcctttcgaatgat
ggtgttgatgagcatatggtttggttgataggattgaagaatatatttgctagacaactt
cccaatatgccgaaggagtacattgtccgacttgttatggataggagccataagtctgta
atggttataaggcgtaataacgttgttggaggcattacatatcgtccatatgcaagccag
aagttcggtgagatagccttttgtgcaattacggctgatgagcaagtaaaaggttatggt
accagattgatgaatcacttaaagcagtatgcccgtgatatagatgggctgacacatttt
ctcacatatgctgacaacaatgctgttggctattttatcaaacagggatttactaaagag
attcacttggagaaagatagatggcaaggttacataaaagattatgatgggggaattctc
atggaatgtaagattgatccaaagcttccttacactgatttgtcaactatgattcgtcgt
caaagacaggcaatagatgaaaagattagagaactgtcaaactgtcacattgtttatgct
ggaattgattttcagaagaaagaagctggtattcctaagaaaattgttgatgacatccct
ggtttgagagaggctggatggactcctgatcagtggggtcattcgcggttcagaacttta
ggtggttctaccgacactgctacaaatctaaaacatttgactgcatttatgcgatcactt
cttaagtcgatgcatgatcatgctgatgcttggccattcaaggaacctgttgatgcacgg
gatgttcctgattattatgacatcatcaaagatccaatggatctgaagacaatgagtaag
agggtggagtcagaacaatattacgtcacatttgagatgtttgttgaggatgtcagaaga
atgtttgcgaatgcacgcacctataattctccagaaaccatttattacaaatgtgctaca
aggctagaagcccactttcaaagcaaagtgacatcggtcctccagttaggctccaaaatt
cagtag

DBGET integrated database retrieval system