KEGG   Cicer arietinum (chickpea): 101504066Help
Entry
101504066         CDS       T02819                                 

Definition
probable pectinesterase/pectinesterase inhibitor 33-like
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101504066
   00500 Starch and sucrose metabolism
    101504066
Enzymes [BR:cam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     101504066
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca5
AA seq 524 aa AA seqDB search
MAIFEKTFFILLLLSSIFSIVSSRKGPSSSNIDWWCNQTPHPKPCKHYTTQMNNHFKIKH
KSEFRGMLVQLALKQALIMQKESQNSQQNSSVHQTVHDDCLKLFRNTIFHLNRTFEGLNN
ASKNCSPDDAQTWLTTSLTNIETCKNGAFELNAKDFNFIVQTNVIEMIRNSLAINMYFMK
HNRETKEGFYPNWFSRHERKLLNANSIVKANLVVAKDGSGNFKTVQAALDASAKRKYKTR
FVIHIKKGVYRENIEVAVHNDNIMLVGDGMQNTIITSSRSVQGGYTTYSSATAGIDGLHF
IARDITFQNTAGPQKGQAVALRSASDLSVFYRCAISGYQDTLMAHAQRQFYRQCYIYGTV
DFIFGNAAVVFQNCNIFVRKPLDGQANMITAQGRGDPFQNTGISFHNCKIRAASDLKPVI
DKYNTFLGRPWQQYSRVVVMKTFMDTLVSPLGWSPWGDTDFAQDTLYYGEYENYGPGSST
AHRVKWPGYHVITSPNEASKFTVTGLLAGPTWLATTTVPFTSGL
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggcaatctttgaaaaaacatttttcatactcttattattatcttcaattttctcaata
gtttcatcaagaaaaggaccttcatcaagcaacatagattggtggtgcaaccaaacacca
catccaaagccatgcaaacactacacaactcaaatgaacaatcatttcaaaatcaaacac
aaaagtgaattcaggggaatgcttgttcaattagccttaaaacaagctcttatcatgcaa
aaagaatcacaaaattctcaacaaaattcatcggtacatcaaaccgttcacgacgattgt
ttgaaattgtttcgaaacacaatctttcatcttaaccgtacatttgaaggtttaaacaat
gcaagcaaaaattgttcaccagatgatgcacaaacatggctcacaacatctctcacaaat
attgagacatgtaaaaatggagcttttgaactcaatgctaaagatttcaatttcattgtg
caaaccaatgtcattgagatgataaggaatagcttagccatcaacatgtattttatgaaa
cacaacagagaaacaaaagaaggtttttatccaaattggttttctagacatgagaggaag
ttgttgaatgctaattcaatagttaaagcaaatcttgtggtggcaaaagatggttctgga
aattttaagacagtgcaagctgctttggatgcttctgctaagagaaaatataagacaagg
tttgtgatacatataaagaaaggagtttatagagaaaatattgaggttgctgttcataat
gataacattatgttggtcggtgatggcatgcaaaatactataataacaagttctagaagt
gttcaaggaggttatactacttatagttctgctacagctggaattgatgggcttcacttt
attgcacgtgacattaccttccaaaataccgcaggcccccaaaagggtcaagccgtggcg
cttcgatccgcctcggacctctccgtcttctataggtgtgccatatccggttaccaagat
actctcatggctcacgcacaacgtcaattttatagacaatgttatatctatggcaccgta
gatttcatctttggaaacgccgcagtggttttccaaaattgtaacatttttgttagaaag
cctttagacggccaagccaatatgatcacggcccaaggtcgtggcgatccgttccaaaac
acgggaatttcatttcacaattgtaaaattagggctgcttcagatctaaagcccgttatc
gacaagtacaataccttcttgggccggccttggcaacaatactcaagagtggtggtaatg
aaaactttcatggacactttagtaagcccattgggttggtctccatggggtgatactgat
tttgctcaagatacattgtattatggagagtatgaaaactatgggcctggttcatctaca
gcccatagagtgaaatggcctggttatcatgtgataacaagcccaaatgaagcctcgaag
tttacggttactggactccttgcaggcccaacatggttggctaccactactgtgccattt
acttctggtctttga

DBGET integrated database retrieval system