KEGG   Cicer arietinum (chickpea): 101504326Help
Entry
101504326         CDS       T02819                                 

Definition
histone acetyltransferase type B catalytic subunit-like
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
cam  Cicer arietinum (chickpea)
Brite
Enzymes [BR:cam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101504326
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca2
AA seq 458 aa AA seqDB search
MGQKQKQSLELDLTETKKRRRVGFSGTDAGVEAKDCIRIFLVSSKEEFDDPESFVVNPVD
LNGFFDGEGKIYGYEDLKISIWISSISFYAYADITFRSSADRGKGITELKEALQAIFAET
LVDSKDEFLEKYLVDRNFLRTNISDGKVLKTKAFNHTGSDASDVEVVRLVAGNMATGQLY
SHIIPLTLLLVNGSSPIDVTDSQWELYVLVQKKADEQGEIQSMLLGFTAVYRFYHYPDDS
RLRLGQILVLPPYQRKGYGCFLLEALYDFAISENVFDITIEEPLDELQNLRSCVETRRLL
RFEPIQPLVAKAVSLLKSGRLSKKTHIPRVLPPPSAIDDVRKNLKITKKQFLQCWEVLIY
IGLIPVDKYMENFVNIVSARLKYDILGKDFGTAGKQVLEVPNDVDEEMSFVMIKSGAGED
ITAMTEDSGTNREEELEKLVQHRVKEIQLIAKKLTSNV
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgggacagaaacagaagcagagtttggaattggatctcaccgaaaccaaaaaacgacgt
cgtgttggattttccggcacagatgctggagttgaagccaaagactgcatcagaatcttt
cttgtgtcaagcaaagaagagttcgatgatcctgagagttttgtagtcaatcctgttgat
ttgaatggcttttttgatggcgaagggaagatttatggttatgaggatttgaagattagc
atctggattagcagcatatctttttatgcatatgctgacattacattccggagttcggct
gatcgaggcaaagggattacagaacttaaagaggctctacaggcaatttttgctgagact
cttgttgatagcaaagatgaattccttgaaaaatatttggtggacaggaattttcttaga
acaaacatctcagatgggaaggttttgaagacaaaagctttcaatcacactggttcggat
gcttcagatgttgaggttgttcgtctggtggcaggcaacatggctactggacaactttac
agtcatataataccacttacccttctccttgtcaacggtagcagtcccattgatgtaact
gattcacaatgggagctgtatgtcctggttcagaagaaagctgacgagcagggagagatt
caatctatgttgcttggatttactgctgtttatcgattttaccactatcctgacgactcc
cgattgcgtcttggtcagatactggtattgcctccttatcagcgcaagggctatggttgt
ttccttctggaagcactatatgattttgctatatctgaaaacgtttttgacatcactata
gaagagccgttagatgagctccaaaatctccgttcttgtgttgaaacacgtcgcctgctt
cgttttgaaccgattcagcctttagttgctaaggctgtttcacttctaaagtctggaagg
ctatcgaagaaaacacatattcctcgagttttgccgccacccagtgcaattgatgatgtg
aggaaaaatttgaaaattaccaagaaacagtttctccagtgttgggaggtcttgatctac
attggcctcatacctgttgataagtacatggagaactttgtcaacattgtttcggcacgt
ttgaagtatgatatattggggaaagattttgggactgctgggaagcaagttcttgaagta
ccgaacgatgtcgatgaggagatgtcatttgtgatgatcaaatcgggggcgggtgaagat
attactgcaatgacagaggacagtggaacaaaccgagaagaggaactcgagaagttagtt
cagcatagggtaaaagaaattcagttgatcgccaaaaagctaacctcaaatgtttga

DBGET integrated database retrieval system