KEGG   Cicer arietinum (chickpea): 101506967Help
Entry
101506967         CDS       T02819                                 

Definition
alpha-amylase-like
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cam00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca4
AA seq 420 aa AA seqDB search
MDSLPWLSLFCLSIFPLLASSTLLFQGFNWESSSKGGWYNLLKNSIPDLANAGITHVWLP
PPSQSVGSQGYLPGRLYDLDASKYGSKDELKSLIKAFNDKGIKSLADIVINHRTAERKDG
RGIYCLFEGGTPDTKLDWGPSFICKDDTTYSDGTGNLDTGEDYNAAPDIDHLNPQVQREL
SEWMNWLKTEIGFSGWRFDFVKGYAPSITKIYVENTSPDFAVGEYWNSLSYGQDGKCDYN
QDKARGELVNWVESSGAGVVNAFDFTTKGILQAAVEGELWRLKDSNGKPPGLIGLKPENA
VTFIDNHDTGSTQKLWPFPSDKVMQGYAYILTHPGTPSIFYDHLFDWGLKEQITKLTAIR
VRNGINMKSTVNILAADGDIYVAKIDNKIIVKIGPKMDLGNLVPSNFHVATSGQDYAVWE
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggattctcttccttggctcagtcttttctgcctttcaatttttcctcttttagcttcc
tctactttgctctttcagggattcaactgggaatcaagtagcaaaggaggatggtacaac
ttgttgaagaactccattcctgacttagcaaatgcaggaattactcatgtttggctccct
cctccatctcaaagtgttggttctcaagggtatcttccaggaagactatatgatcttgat
gcatcaaaatatggttccaaggatgaactaaagtcccttataaaggcctttaatgataaa
ggaataaagagcctagctgacatagtaatcaaccatagaactgcagagagaaaagatgga
agaggtatttactgtctctttgaaggtgggaccccagatacaaaacttgattggggtcca
tctttcatttgcaaagatgacacaacttattcagacggcactggaaatcttgatactgga
gaagattacaatgctgcacctgacattgatcatttaaatcctcaagtacaaagagagtta
tctgaatggatgaattggttaaaaactgaaattggtttttctggatggagatttgatttt
gtgaaaggttatgctcctagtataacaaagatttatgtggaaaatacttcaccagatttt
gctgttggagagtattggaattcactttcttatggacaagatggaaagtgtgattataat
caagataaagctagaggtgaacttgtgaattgggttgaatctagtggtgctggtgttgtt
aatgcatttgattttactactaaagggattcttcaagctgctgttgaaggagaactttgg
aggttgaaagattcgaatggaaaaccacctggtttgattggtttgaaacctgaaaatgct
gttacatttattgataaccatgatacaggttctactcagaaactttggccatttccttct
gataaagttatgcagggttatgcttatatattaacacatcctgggacaccatcaatattc
tacgaccacttatttgattggggactgaaggagcagataacaaaattgacagcaattaga
gtgaggaatgggatcaacatgaaaagcacagtgaacattctagcagcagatggtgacatt
tatgtggcaaagatagataacaagattattgtgaagataggtccaaagatggaccttgga
aatcttgttccctcaaatttccacgttgctacctctggtcaagattatgccgtgtgggag
tga

DBGET integrated database retrieval system