KEGG   Cicer arietinum (chickpea): 101507863Help
Entry
101507863         CDS       T02819                                 

Definition
(RefSeq) histone acetyltransferase HAC1-like
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
cam  Cicer arietinum (chickpea)
Brite
Enzymes [BR:cam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101507863
Transcription factors [BR:cam03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    101507863
Chromosome [BR:cam03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101507863
Mitochondrial biogenesis [BR:cam03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101507863
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Ca1
AA seq 1731 aa AA seqDB search
MKLQAHIPGQISGQVPNQAGSQLPGLTQLNGNAFPSQMPSLGGVSRSAINMDPEFLRARA
FIQEKICDMLLQRHQQPITEMQRRRIKDLSKRLEEGMLKAALSKEDYMNLDTLESRLSNF
LRRASMNNHNQQYPQLVSSSPIGTMIPTPGMSHGPNSSMVVSSSIDASMISSSGCNSIVS
TSFNSVNMLPAGGMLGSSLNRSDGLSNGYQQSSTSFSVGSGGNMSSMGVPRISSQMIPTP
GFTVNSNHSHLNIDSSTNGSVFSSAESTMVTQSQLQQQKQNVGDQSHLLQNLGSQMSSGM
RSGLLQKPFTNSNGTINNGLGLIGNNIQHANEAGTSDGYASTYVNSPKHTHQHFDQNQKT
VVQGDGYGLNNVDTFASGNFYASATSSGSMMNTQNTNSVKLTSIPKTNSLISGHSNLHGM
QQAAHIKSQAINHLEKLNFQSSSTSRDALLHSQQQYQQKPQQFQQPEPYSQSQQQFQLKL
HSQQPQHLVNNDAFNQSQLSSNLENQVKSEPGLEHHKEVLNSHVPEQFHMSEMQNQFQQN
SSEDCTRSAQYLSFPSGQHELTSSAPQNSQQMLHPHQLVAESQNKFSCLTVGAQSNSKSI
VLNQWPDSQDGNHMPNNISHDQHLHVDFHQRISGKDEAHCNNLSSDVSMSQAAAPRGAAE
PLDPGSAIKKAHRNQQRWLLFLLHARRCSAPEGRCQERFCSIAQKLCKHIDGCTLRHCPY
PRCHHTRVLLHHFIHCKDLCCPVCVFVRNYRRTFQLKPQIQPESESSLPSMVNGSCKSYN
ITAMSSRLISKPPLVVETSEDMHPSLKRIKIEHCTQSVNLENDNSASSVSANCESLVSRD
AQSQTYPNAEKSISIKSELTEVKAEASAHAKLSEMKMDSNNTDGKILDGESVKYDDPSNL
ARPENIKTEKEIGPDKQENVMQQCENAAGTKSGKPKIKGVSLTELFTPEQVREHITGLRQ
WVGQSKSKAEKNQAMEHSMSENSCQLCAVEKLTFEPPPIYCTTCGVRIKRNNMYYTMGTG
DTRHYFCIPCYNDARTEHIVVDGTPIAKSRLEKKKNDEETEEWWVQCDKCEAWQHQICAL
FNGRRNDGGQAEYTCPNCYIEEVEQGERKPLPQSAVLGAKDLPRTILSDHIEQRLFKRLK
HERQERARFHGKSYDEVPGADSLVVRVVSSVDKKLEVKQRFLEIFQEENYPTEFPYKSKV
VLLFQKIEGVEVCLFGMYVQEFGAECQFPNQRRVYLSYLDSVKYFRPEIKSVTGEALRTF
VYHEILIGYLEYCKKRGFTSCYIWACPPLKGEDYILYCHPEIQKTPKSDKLREWYLAMLR
KAAKENVVVDITNLYDHFFTSTGECRAKVTAARLPYFDGDYWPGAAEDLIYQLRQEEDGR
KQNKKGTTKKTITKRALKASGQSDLSGNASKDLLLMHKLGETISPMKEDFIMVHLQHACT
HCCILMVCGNRWVCNQCKNFQICDKCYEAELKREERERHPVNQREKHTLYQVEITDVPSD
TKDRDDILESEFFDTRQAFLSLCQGNHYQYDTLRRAKHSSMMVLYHLHNPTAPAFVTTCN
ICYLDIETGQGWRCEVCPEYDVCNSCYQKGGIDHPHKLTNHPSMVDRDAQNKEARQHRVL
QLRKMLDLLVHASQCRSAHCQYPNCRKVKGLFRHGMHCKTRASGGCVLCKKMWYLLQLHA
RACKESECHVPRCRDLKEHLRRLQQQSDSRRRAAVMEMMRQRAAEVASNAG
NT seq 5196 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacaggcacatattccaggacagatatcaggacaggtacccaatcaagcaggg
tctcagttgcctggactcacccaattgaatggaaatgctttcccttcacagatgccatct
ttaggtggtgtatcacgatccgcaattaatatggaccctgaatttcttagagcacgtgca
tttattcaagagaagatatgtgatatgttattgcaacggcatcagcagccaattactgaa
atgcagagaaggaggattaaggatctttcaaaacgcctcgaggagggcatgttaaaagct
gctctctctaaggaggactacatgaacttggatacactagagagtcgtttatctaatttc
ctccgacgagcatctatgaataatcacaaccaacagtatccccagcttgttagctcttct
cccattggtacaatgataccaacccctggtatgtcgcatgggccaaattcaagcatggtg
gtttcatcttctatagacgcctcaatgatttcttccagtgggtgtaatagcatagtatca
acatctttcaacagtgtaaatatgttaccagctggtggcatgcttggcagttccttaaat
agatctgatggtttgtcaaatggatatcaacagtcttctaccagcttttctgttggctcg
ggggggaacatgtcatcaatgggtgtgccgagaatttcaagccagatgattcctacgccg
ggatttacagtcaacagcaatcactcacatctgaatatagattcgtctactaatggaagt
gtcttttctagtgcagagtctactatggtaacacagtcacagctgcagcagcagaaacag
aatgttggtgaccaaagtcatctattgcagaaccttggcagccaaatgagtagtggaatg
agatctggtttgctacaaaaaccatttacaaactcaaatggtactataaataatgggcta
ggcttgattggtaacaatatccaacatgcaaatgaagcaggaacttccgatggctatgcc
tcaacttatgtcaattcccctaaacacacacatcaacactttgaccaaaatcagaaaaca
gtagtgcagggtgatgggtatggattgaataatgttgacacttttgcttctggaaacttt
tatgcatctgcgacatcttctgggtctatgatgaacactcagaacacgaattcagtaaaa
ttgacatcaatacccaaaactaactcattgatcagtggtcactcaaatttgcatggtatg
cagcaggctgctcatataaagtctcaagcaatcaatcacttggaaaaattgaattttcag
tcttcatcgacttcaagagatgcccttctgcattctcaacagcagtatcagcaaaagccc
cagcaatttcaacagccagagccgtattcacaatcacaacaacaatttcaattgaagcta
catagtcaacagcctcagcatttggtcaacaatgatgctttcaatcagtctcagctgtct
tccaatctagaaaaccaagtgaagtcagagcctggacttgaacaccataaagaagtgctc
aattctcatgttcctgaacagttccatatgtctgagatgcagaatcagttccagcaaaac
tcatctgaagattgcactaggagtgctcaatacctttcatttccatctggtcagcatgag
ttaacctcatcagcaccacaaaattcgcaacaaatgttgcatccacaccaattggttgca
gagtctcaaaataagttcagctgtcttacagttggggcacaatccaattccaaatcaata
gttctaaaccaatggcctgactcacaagatggcaaccacatgcctaacaatatttcacat
gaccagcatctccatgtggattttcatcaaagaatatctgggaaggatgaagctcattgc
aataatttatcatcagatgtatctatgagccaagctgctgctcctagaggtgcagctgag
ccactagacccgggaagtgctatcaaaaaggcacacaggaatcaacaaaggtggctttta
tttctacttcatgctcgacgatgttctgctcctgaaggacgatgccaagaacgcttttgt
tctattgcacagaagttatgtaagcacatagatggatgcaccctgcgacattgtccatac
cctcgttgtcatcataccagggtattgcttcatcatttcatacactgcaaggatctatgt
tgccctgtttgtgtttttgtaagaaattaccggcgcacatttcaactcaaacctcagatt
cagccagaatctgaatcaagtttgccaagtatggtaaatggatcctgtaaatcttacaat
ataacagccatgtcatctagattgatatcgaagcctccattagttgtggaaacttcagaa
gacatgcacccatctctaaagcgcataaagattgagcattgcacccagtctgttaatctt
gaaaatgacaattctgcttcatctgtttctgcaaattgtgaatctcttgtttccagggat
gctcagtcccaaacctatcccaatgctgagaagtctatctcaattaaatcagagcttaca
gaagtaaaagcagaagcatcagctcatgcaaagcttagtgagatgaagatggattccaat
aatacagatggtaaaattcttgatggtgagtctgttaagtatgacgatcctagtaattta
gccaggccagaaaatataaaaactgagaaagaaattggaccagataaacaagaaaatgtg
atgcagcaatgtgagaatgcagctggaacaaaatctggtaagccaaaaataaagggggtc
tctttaaccgaattatttactccagagcaagtcagggaacatatcactggtctcaggcaa
tgggttggccaaagcaaatcaaaggcagagaagaatcaagcaatggagcactctatgagt
gagaattcctgtcagttatgtgctgtagagaagcttacatttgaaccacctcctatttat
tgtacaacatgtggggttcgcatcaagcgaaacaatatgtactataccatgggtactggt
gatactcgacattatttttgtatcccatgctataatgatgctcgtacagaacacattgtt
gttgatgggactcccattgccaagtcaagattggaaaagaagaagaatgatgaggaaacc
gaggaatggtgggttcaatgtgataaatgcgaagcttggcaacaccaaatatgtgccttg
tttaatggaagaagaaatgatggtggacaagctgaatacacttgccctaactgctacatt
gaagaggtagagcaaggagagcgcaaaccattaccccaaagtgctgttcttggagcgaag
gatttaccgagaactattcttagtgaccatatagaacaacggttgtttaagcggctaaag
cacgaaaggcaagagagagcaaggtttcatgggaaaagctatgatgaggtgcctggagct
gattctcttgtcgtaagagttgtgtcatctgttgacaagaagttagaagtgaaacagcgt
tttttggagatttttcaggaagaaaattacccaacagaattcccatataaatcaaaggta
gttttgctatttcaaaagattgaaggtgtggaagtatgcctatttggcatgtatgttcaa
gaatttggagctgaatgtcaatttcccaatcagcgccgggtgtatctttcatatttggac
tctgtgaagtatttcaggcctgagattaaatcagtaactggagaggctcttcgaacattt
gtttaccatgaaattctgattggatatcttgaatattgtaagaaacgtggttttaccagc
tgctatatatgggcttgtcctccattaaagggtgaagactatattttatattgtcatcca
gaaattcagaaaacgccaaaatctgataagcttcgtgaatggtatctagccatgttaaga
aaagctgctaaggagaatgttgtggtcgatatcaccaacttatatgatcatttcttcaca
tctaccggtgaatgtagggctaaggttacggcagcaagactcccatattttgatggtgac
tactggcccggggctgcagaagatttgatctatcagctacgtcaagaggaagacggaaga
aaacaaaataaaaaaggaacaaccaaaaagactattacaaaaagggctttaaaagcttct
ggtcagtcagatctttcaggaaatgcctcgaaagatctgctcctcatgcacaaacttggc
gaaaccatttccccgatgaaggaagattttattatggttcatttgcagcatgcatgtacc
cactgctgtattctaatggtgtgtggtaaccgttgggtttgtaatcagtgcaagaacttt
cagatttgtgataagtgttatgaagcagagctaaagcgtgaagagagagaaagacatcct
gttaatcagagggaaaaacatactctttatcaagttgaaattactgatgtaccatctgat
acaaaggatagagatgatattcttgaaagtgaattctttgacactagacaggcatttctg
agtctctgccagggaaatcattaccagtatgatacactaaggcgggccaagcattcctca
atgatggtcctatatcatcttcataatccaactgctcctgcatttgtgacaacttgtaat
atatgctatcttgacatagaaactggtcaaggttggcgttgtgaagtttgcccagagtac
gatgtatgcaattcttgttatcaaaagggaggcattgatcatcctcataagttgacaaat
catccgtcaatggtggatcgtgatgctcagaacaaagaagcaaggcagcatagagtattg
cagctaaggaaaatgctcgatcttctagtgcatgcatcccaatgtcgctctgcacattgc
caatatcctaattgtcgtaaagtgaagggccttttccgccatggtatgcactgcaaaaca
cgtgcttctggaggttgtgttctttgcaagaaaatgtggtatttgcttcaacttcatgct
cgtgcgtgcaaagaatccgaatgccatgtaccacgatgcagagatttaaaagaacattta
aggaggctgcagcagcagtctgattcacggcgtagagctgctgtaatggaaatgatgagg
cagagagcagcagaagttgctagcaatgctggatga

DBGET integrated database retrieval system