KEGG   Cicer arietinum (chickpea): 101508047Help
Entry
101508047         CDS       T02819                                 

Definition
endoglucanase 24-like
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cam00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca5
AA seq 496 aa AA seqDB search
MALGKPLLKLCVFVAVLVVVIGGSSGAHDYQEALSKAILFFEGQRSGFLPEDQRLKWRGN
SGLSDGWNYNFDLTGGYYDAGDNVKFGFPMAFTTTMLSWSVIEFGDNMPPNELRNALVAI
RWSTDYLLKTVSQPNRIFVQVGDPIADHNCWERPEDMDTSRSVYAIDAPNPASDVAGETA
AALAASSMAFRSSDPGYSETLLRSAVKAFEFADSYRGAYSDNANVKDGVCPFYCDFDGYQ
DELLWGAAWLRRATQDENFLNYIQSNGKTLGAEDNINEFGWDNKHAGLNVLVSKEVLEGN
VYSLDSYKASAESFLCTLIPETSSSHIEYTPGGLIYRPGGSNLQHATSIAFLELVYANYL
SRTSQSINCGNVYVSAQTLRERAKRQVDYILGDNPLGLSYMVGYGNNYPQRIHHRGSSLP
NIKDHPQKIACKEGSIYFNSTNPNPNVLVGAIVGGPGEDDVYMDDRADYIKSEPTTYINA
PFVGVLAYFANNNNPN
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggcattgggcaaaccgttattgaaattgtgcgtatttgttgcggtgcttgtggtggtc
attggaggaagcagcggtgcacatgattatcaggaggcattatcgaaggcgatactcttc
ttcgaaggacaacgatcggggtttctgccggaggaccagagattgaagtggcgtgggaat
tcgggtctcagtgatgggtggaattacaacttcgaccttaccggcgggtattacgacgcc
ggtgataatgtgaaatttgggtttccgatggcattcacgacgacaatgttgtcgtggagt
gtaattgaattcggtgacaacatgcctcccaatgaactcagaaacgctttggtcgcaatt
cgttggagtactgattatttgttgaagaccgtttctcagcccaatcgcattttcgttcag
gtgggtgacccaatcgcagaccacaactgctgggagaggccagaagacatggacacaagc
aggagtgtgtatgctattgatgcacctaacccagcttcggatgtcgccggcgaaaccgca
gctgcccttgccgcttcatccatggcattccgatcatcggaccctggttattcagagaca
ttactccgaagtgctgttaaggccttcgaatttgcagatagttacaggggtgcatacagt
gacaatgctaatgttaaggatggtgtctgccctttttattgtgattttgatggataccag
gacgaattgttatggggtgccgcatggttaaggagggcgacacaagatgaaaatttcctc
aactacattcaaagcaatggtaaaacacttggtgctgaagacaacataaatgaatttggt
tgggacaacaagcatgctggcctcaacgttcttgtctccaaggaagtcctagaaggaaat
gtatattctcttgactcttacaaggcatcagcagagagcttcctatgcacactaatacca
gaaacatcaagttcacacatagagtacactcctggtggactcatatacagaccaggtgga
agcaatttacaacatgcaacatcaattgcattcctcgaattagtctacgccaattactta
tctcgcacgtcacaatccatcaactgtggtaacgtttatgttagtgcacaaacacttcgt
gaacgtgctaagagacaagttgattacattttaggtgataatccattgggtttatcttac
atggttggttatggtaacaattatccacaacgtattcatcaccgtggttcatctttacct
aacattaaggatcatcctcaaaagattgcttgcaaagaaggttcaatttacttcaattca
acaaatcctaacccaaatgttcttgttggagccattgtgggcggacctggtgaagatgat
gtttatatggatgacagggctgattatataaagtctgagccaaccacatatattaatgca
ccatttgttggggttttagcatactttgctaataataataatcctaattaa

DBGET integrated database retrieval system