KEGG   Cicer arietinum (chickpea): 101508164Help
Entry
101508164         CDS       T02819                                 

Definition
(R)-mandelonitrile lyase-like
Orthology
K08248  
mandelonitrile lyase [EC:4.1.2.10]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Cyanoamino acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of other amino acids; Cyanoamino acid metabolism [PATH:cam00460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca6
AA seq 580 aa AA seqDB search
MEKSAITVTTEFLFLTSFITIFIGSAFASPTQNQESNSQEQQDKPPSYLRMVANASEFPL
EDYYDYIIVGGGTAGCPLAATLSQNYRVLVLERGGVTHGKSNLMNQEGFLNTLLNANVNN
ANNEDSPAQSFISEDGVLNARGRVLGGSSAINAGFYSRADHEFFTRSGVIWDSKLVNESY
EWVEREIVFRPQLKTWQSAFRDGLLEARVGPYNGFTLDHATGTKIGGSTFDTSGKRHSSA
DLLRYARHSNLRIAVYASVERILLASSSSSTTTSSETSSSATTSAIGVLYRDQNGKYHHA
ILRGRGEVILAAGAIGSPQLLLLSGIGPRPYLSSWGIPVTHHLPYVGHFLYDNPRNGITF
LPSIPLEHSLIQVVGITNSGAYIEAASNVVPFSSPVRNFFIRESNSPLYLTVATLISKIS
GPVSAGFLRLASTDVRFNPIVRFNYFNNGVDVERCVNGTRKLGEVLRSRAMNDFKFVNWL
GVRDFRFIGPALPNDESDYIEMADFCRRTVSTIWHYHGGCVVGRVVDSHLKVIGIDSLRI
VDGSVFSVSPGTNPQATLMMLGRYFGLKMIREREGYSNDL
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggagaaatctgccataaccgttacaacagagtttctatttctcacatctttcatcaca
atattcatcggttctgcattcgcttctccaacacaaaatcaagaatctaactctcaagaa
caacaagataagccgccgagttacttaaggatggtggctaacgcaagcgagtttccctta
gaagattactacgattacataatagtcggcggcggaacagccggctgtccattagccgcc
acactctcccaaaattaccgcgtattagtcctcgaacgtggtggagttacccacggtaaa
tccaatttaatgaaccaagaaggtttcttgaacacattattaaacgcaaacgtaaacaac
gccaacaacgaagactcaccggctcaatcattcatttcagaagacggcgtactcaacgca
cgtggccgcgttctcggcggtagtagcgcaattaacgccggcttttatagccgagccgat
cacgaattttttacacgctccggtgttatttgggactcaaaacttgtgaacgaatcttac
gaatgggttgaaagagaaatcgtttttcgtcctcaacttaaaacgtggcaatccgctttt
cgtgatggtcttctagaagctcgtgtgggtccctataacggtttcaccttagatcacgct
actggtaccaaaattggtgggtccacttttgatacttcaggtaaacgacatagttccgca
gatcttttacgctatgcacgacactccaatcttcgcattgccgtttacgctagcgtcgaa
cgaatccttctcgcttcttcatcatcttcaacaacaacgagttctgaaacttcttcttct
gcaacaacttctgcgattggagttctttatcgcgatcaaaacggaaaatatcatcacgcg
attttgagaggacgcggagaagtgattcttgcagcaggtgcaattggaagtccacaactt
cttctattaagtggaattggacctagaccttatctttcttcatggggaataccagtgaca
catcatttaccatacgtaggtcattttctatacgataatccacgtaacggaatcactttt
ctaccttcaattccacttgaacattcgcttatacaagttgtaggtataacgaattcaggt
gcttacatagaagcagcttctaatgttgttccgttttcatcaccggttcggaatttcttc
atccgtgaatctaattcgccgctttatctaactgttgcgacgttgatttcgaagatttca
ggacctgtttctgctggttttctaagattagcttcaactgatgttaggtttaatccaatt
gttaggtttaattactttaacaacggtgttgatgttgaaaggtgtgttaatggaacaagg
aaattaggggaagtacttaggagtagagcaatgaatgattttaagtttgtgaattggtta
ggtgttagagattttaggtttattggacctgctttgcctaatgatgaaagtgattatatt
gaaatggctgatttttgtagaaggactgttagtactatttggcattatcatggtggttgt
gtggttggtagggttgttgattcacatttgaaagtcattggaattgattctcttcggatt
gttgatggttctgtttttagtgtttcacctggaactaatcctcaagctacattaatgatg
ttgggaaggtattttgggctaaagatgattagagaaagggaaggatattcaaatgatttg
taa

DBGET integrated database retrieval system