KEGG   Cicer arietinum (chickpea): 101508288Help
Entry
101508288         CDS       T02819                                 

Definition
(RefSeq) glutamate--glyoxylate aminotransferase 2
  KO
K14272  glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00220  Arginine biosynthesis
cam00250  Alanine, aspartate and glutamate metabolism
cam00260  Glycine, serine and threonine metabolism
cam00630  Glyoxylate and dicarboxylate metabolism
cam00710  Carbon fixation in photosynthetic organisms
cam01100  Metabolic pathways
cam01110  Biosynthesis of secondary metabolites
cam01200  Carbon metabolism
cam01210  2-Oxocarboxylic acid metabolism
cam01230  Biosynthesis of amino acids
Module
cam_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
cam_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    101508288
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101508288
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101508288
   00260 Glycine, serine and threonine metabolism
    101508288
   00220 Arginine biosynthesis
    101508288
Enzymes [BR:cam01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     101508288
    2.6.1.4  glycine transaminase
     101508288
    2.6.1.44  alanine---glyoxylate transaminase
     101508288
Amino acid related enzymes [BR:cam01007]
 Aminotransferase (transaminase)
  Class I
   101508288
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 101508288
NCBI-ProteinID: XP_004489787
UniProt: A0A1S2XJY6
Position
Ca2
AA seq 481 aa AA seqDB search
MPPKPLDYESINENVKKAQYAVRGELYLRATELQKEGKKIIFTNVGNPHALGQKPLTFPR
QVVALCQAPFLLDDPNVGLIFPADAIARAKQYLSLTSGGLGAYSDSRGVPGVRKEVAEFI
QRRDGYPSDPEFIYLTDGASKAVMQILNTIIRGQGDGILVPVPQYPLYSATIALLGGSLV
PYYLEETANWGLDTIELRRSVAEARRKGLTVKAMVIINPGNPTGQCLSEANLREVLQFCY
EENLVLLGDEVYQTNIYQDERPFISSKKVLMDIGPPLSKEVQLVSFHSVSKGYYGECGQR
GGYFEMVNISPETVDEIYKVASISLSPNVPAQIFMGLMVNPPKPGDISYEQYLRESKGIL
GSLRRRARIMTDGFNSCRNVVCNFTEGAMYSFPQIVLPPKALETAKQAGKAPDVFYCLKL
LEATGISTVPGSGFGQKEGVFHLRTTILPAEEEMPAIMDSFKKFNDDFMEQYEDHRGYSR
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaaaacccttagactatgagtcgataaacgaaaatgtgaagaaggctcagtat
gctgtcagaggtgaactataccttcgagctaccgagcttcagaaggagggcaaaaagatt
atattcactaatgttggcaacccacatgctttgggacagaaaccactgaccttccctcgc
caggttgttgctttgtgccaggctcctttcctacttgatgatcctaacgttggactgata
ttccccgccgatgcaattgcaagagctaaacagtatctctcgttgacatcgggtggttta
ggtgcttatagtgattctcgaggtgttccaggagtgaggaaggaagtggcagagttcata
cagaggcgtgatggttatccaagcgatccggagttcatatatcttaccgatggtgcgagc
aaggctgtgatgcagatattaaataccatcattagaggccaaggagatgggattttggtt
ccagtcccacaatatccactctactctgcaacaattgctcttcttggtggttctcttgtt
ccgtactacctcgaagaaacagcgaattggggtcttgatactattgaacttcgtagatca
gttgctgaggctcgccgtaaaggattaactgttaaagcaatggtgatcataaatcctgga
aaccctactggtcaatgccttagtgaagcaaatttacgagaggttttgcaattttgttac
gaagaaaatttagtcttgctcggagatgaggtttaccagacaaatatatatcaggacgaa
cgacccttcattagttctaaaaaggttttgatggacattgggccacctctgagcaaggaa
gttcagcttgtttcttttcactcagtgtcaaaagggtattatggtgaatgcggacagcgg
ggtggatattttgaaatggtcaacatttctccagagacagttgatgagatctataaagtt
gcatcaatatcacttagtccaaatgttccagcacaaatatttatgggactaatggtcaat
ccacccaaacctggagatatttcttatgagcaatatcttagggaaagcaaaggaatactt
ggatcactaagaagaagagcaaggataatgactgatggattcaacagctgcaggaatgtt
gtttgtaatttcacagaaggtgccatgtattcattccctcaaattgtattgccaccaaaa
gctttagagactgctaaacaggctggaaaggctcctgatgttttctactgtctcaagctt
ttggaagctactggcatatctactgttcctggttcaggatttggacagaaagaaggggtg
ttccatttgaggacaactatattaccagctgaggaagaaatgcctgctattatggatagt
ttcaaaaagttcaatgatgatttcatggagcaatatgaagaccatagaggttattcaagg
ttgtaa

DBGET integrated database retrieval system