KEGG   Cicer arietinum (chickpea): 101510967Help
Entry
101510967         CDS       T02819                                 

Definition
ribokinase-like
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    101510967
Enzymes [BR:cam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     101510967
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca1
AA seq 352 aa AA seqDB search
MTQTAFSVSPPNHWLQTNQSNPNTFTTLRTPIQFLRFPNTNNQNDKKYLQTLRFTLNSSS
HTPPPVVVVGSVNADIYVDIDRLPKEGETVSAKSGQTLAGGKGANQACCGAKLSHPTYFV
GQIGSDAHGNLVADALRDGGVRLDYLTVVPSAPTGHAVVMLQSDGQNSIVIVGGANMSFW
PQSLPRQHLELVSNAGIVLLQREIPDFVNIQVAKAARNAGVPVIFDAGGMDAPIPQELLD
YVDIFSPNETAAKCNKLGVKQVLVKLGAEGSVLFIEGEEPIQQPAIFAKTVVDTTGAGDT
FTAAFAVALVEGKSKKECLRFAAAAASLCVQVKGAMPSMPDRKSVLELLNHH
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaacagcgttttcagtttcaccaccaaaccattggctccaaacaaatcaatca
aacccaaatactttcaccactttacgaaccccaattcaattcctccgtttccccaacaca
aacaatcaaaacgacaaaaaatacctccaaaccctgcgtttcactttaaactcatcttca
cacaccccaccaccagtcgtcgtcgtagggtccgtcaatgcggacatctatgttgacatc
gacagactccctaaagaaggcgaaaccgtttccgcaaaaagcggccaaactttagccggc
gggaaaggtgctaatcaagcttgctgcggtgctaagctgtcgcatccgacttattttgtt
ggtcagattgggagtgatgctcatggaaacctcgttgctgatgctctccgtgacggcggt
gttcggcttgattatctgaccgttgtgccgtctgctccgacaggtcatgctgttgttatg
cttcagtctgatggacagaattctattgttattgttggtggtgctaatatgagtttttgg
cctcagagtttgccacgtcagcatttggagcttgtttcgaatgctggcattgttttgttg
cagagggagattcctgattttgttaacattcaagtggcaaaggctgcaaggaatgctggt
gttcccgtaatatttgatgctgggggaatggatgcaccaattccacaagaattactggat
tatgttgatatttttagtcctaatgaaactgctgcaaaatgcaataaattgggagttaag
caagttcttgttaaacttggagccgaaggatctgtcctattcatagaaggagaagaacca
attcagcaacctgccatctttgctaaaacagtcgttgatacaactggtgctggcgatact
tttactgctgcttttgctgtagccttggtagagggcaagtccaaaaaggaatgcctcaga
tttgccgctgctgcagcatctctttgtgttcaagtcaagggagccatgcccagcatgccg
gataggaaatctgttctcgaacttcttaatcatcattga

DBGET integrated database retrieval system