KEGG   Cicer arietinum (chickpea): 101511289Help
Entry
101511289         CDS       T02819                                 

Definition
leucoanthocyanidin dioxygenase-like
Orthology
K05277  
leucoanthocyanidin dioxygenase [EC:1.14.11.19]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Class
Metabolism; Biosynthesis of other secondary metabolites; Flavonoid biosynthesis [PATH:cam00941]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca8
AA seq 353 aa AA seqDB search
MGTMLVQRVESLSLSGIESIPKEYVRPKEELTNIGNIFEEEKKEGPEVPTIDLKEINSSD
ELVRRKCREKLKKAAEEWGVMHLVNHGISHDLINRLKKVGETFFGLSVDEKEKYANDQSC
GKIQGYGSKLANNASGQLEWEDYFFHLIFPEDKRDLSIWPKTPHDYTEVTSEYAKQLRGL
ASKIMEVLSLELGLEGGRLEKEVGGMEELLLQMKINYYPICPQPELALGVEAHTDVSSLT
FLLHNMVPGLQLFYEGKWVTAKCVPDSILMHIGDTIEILSNGKYKSILHRGLVNKEKVRI
SWAVFCEPPKEKIILKPLPQLVTQNQPARFPPRTFAQHIHHKLFRNEEEEDTK
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgggaacaatgttggttcaaagagttgaaagcttatccttaagtgggatagaatcaatt
ccaaaggaatacgtgaggccaaaagaagagttaacaaacataggtaacatcttcgaggaa
gaaaaaaaagaagggcctgaagttccaacaattgatttaaaagaaataaactcttcggat
gaattagttagaaggaaatgtagggagaagttgaagaaagcagctgaagaatggggtgtg
atgcatttagtgaaccatggtatatctcatgatctaattaatcgtcttaagaaagttggt
gaaacattctttggtttgtctgttgatgaaaaggagaaatatgcaaatgatcaaagttgt
ggtaagattcaaggttatggaagtaaattagctaataatgctagtggtcaacttgaatgg
gaagattacttctttcatcttatttttcctgaggataagagggacttgtccatctggcct
aagacaccacatgattatacggaggttacaagcgaatatgcaaagcaactaagagggcta
gctagcaagataatggaagtgttgtctctagaactagggctagaaggaggaaggttagaa
aaggaagttggtggaatggaagagcttttacttcaaatgaaaataaactattacccaatt
tgccctcagccagaactagcacttggagttgaagcccatacagatgtaagttcacttact
ttccttctacacaatatggtgccaggtttgcaacttttctatgagggtaaatgggtcaca
gcaaaatgtgtacctgattcaattctaatgcatattggtgacacaattgaaattcttagc
aatggaaaatacaagagtatacttcaccgtggattggtgaataaggaaaaagttagaata
tcttgggcagtgttttgtgaaccacctaaggaaaaaatcatcctcaagccacttcctcaa
cttgtaactcaaaatcaacctgcacggtttccaccacgcacttttgctcagcatattcat
cacaaactttttaggaatgaggaagaggaagataccaaatga

DBGET integrated database retrieval system