KEGG   Cicer arietinum (chickpea): 101511727Help
Entry
101511727         CDS       T02819                                 

Definition
(RefSeq) probable choline kinase 2
  KO
K14156  choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
cam  Cicer arietinum (chickpea)
Pathway
cam00564  Glycerophospholipid metabolism
cam01100  Metabolic pathways
Module
cam_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101511727
Enzymes [BR:cam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     101511727
    2.7.1.82  ethanolamine kinase
     101511727
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH Choline_kin_N EcKinase Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 101511727
NCBI-ProteinID: XP_004511086
UniProt: A0A1S2YWL4
Position
Ca7
AA seq 406 aa AA seqDB search
MGEAEDLVKTKEVATQISNVINDKENYLDCLPDEAKEILKSLASKWENVLDPNALEVIPL
KGAMTNEVFQIKWQTIEGEMSRKVLVRIYGEGTDIFFDRANEIRTFAFISKNGQGPRLLG
RFPHGRLEEFIRARTLSAPDMRDPSISALIASKMKEFHDLDMPGSKNVNLWDRLRNWLNE
ARRLSSPDEVETFHLETMDKEISLLEKELSETRQRIGFCHNDLQYGNIMLDEVTNSVTII
DYEYASYNPVAYDIANHFSEMAANYHTETPHVLDFSKYPDLEERQRFVQTYLSSSGEQAS
DSEVQQLLDEVEKYTLASHLLWGLWGIISEHVNKIDFDYEEYAKQRFQEYWSRKSDLFSN
DESNVTAGGNGEKALASIANEKSEKSPPISKKLKKLFGLSLFRSKQ
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagctgaagatcttgtaaaaaccaaagaagttgcaacacaaattagtaatgta
ataaatgataaagaaaattatctagattgtttaccagatgaagcaaaggagatattgaaa
tcattagcaagtaaatgggagaatgtattggatccaaatgcattggaagttattcctctt
aaaggtgcaatgaccaatgaagtttttcagataaaatggcaaacaatagaaggggaaatg
tcaagaaaggttctagttagaatctatggtgaaggtaccgatattttcttcgatagggct
aacgagattcgaacattcgcatttatctcgaagaatggacaaggacctcgtttgttagga
cggtttcctcatggtcgccttgaagagttcattcgcgcaaggacattatcagcacctgat
atgcgcgatccatctatttcggctcttatagcttccaaaatgaaggaatttcatgatctt
gacatgcctggttcgaagaatgtgaacctttgggatagattgcgaaattggcttaatgaa
gcgaggcgcttgtcgtctccggatgaagttgagacatttcatttagaaacaatggacaaa
gaaatctctcttctggaaaaggaactgtcggaaactcgccaacgaatcgggttctgccat
aatgatttacaatatggtaacatcatgcttgatgaagtgacaaattctgtgaccataatt
gattatgagtatgcaagttataatcctgtggcatatgatatagcaaaccacttctctgag
atggctgctaattatcatactgaaactccacatgttcttgacttcagtaaatatcctgat
ttggaggaacgtcaaagatttgtgcaaacatatctaagttcatcaggtgaacaagctagt
gatagtgaagtgcaacaactacttgatgaagttgaaaagtatacacttgcaagtcatcta
ttgtggggtctttggggaattatttcggaacatgtgaacaaaattgattttgactatgag
gaatatgcaaaacagaggtttcaagagtactggtcaaggaaaagtgatctttttagcaat
gatgaatccaatgttactgctggtggtaatggggagaaagcattagcatcaatcgccaat
gaaaaatcagaaaagagccctcctatctcaaagaaattgaagaaattgtttggtcttagt
ttatttagatcaaaacagtag

DBGET integrated database retrieval system