KEGG   Cicer arietinum (chickpea): 101512259Help
Entry
101512259         CDS       T02819                                 

Definition
(RefSeq) beta-fructofuranosidase, cell wall isozyme-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    101512259
   00500 Starch and sucrose metabolism
    101512259
Enzymes [BR:cam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     101512259
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Ca7
AA seq 573 aa AA seqDB search
MNISIWLLTLFTIIYGILPIEATHHVFRNLQSLSSHDSSNDQPYRTSYHFQPPKNWINDP
NGPMSYKGLYHLFYQYNPKGAVWGNIVWAHSVSTDLINWTPLDQAISPSQPSDINGCWSG
STTILNGTKPAILYTGIDQFNHQVQNLAYPKNLSDPFLRDWIKSKKNPVMEPTSINMINA
SSFRDPTSGWLGKDGHWRVIVGSKRDTRGIAILYRSKDFINWIEAKHPLYSSKGTGMWEC
PDFYPVLKFSSIGVDTSLNNDDVRHVLKVSLDDKKHDYYLIGSYDDGKDNFVPDKGFQNT
SEFFLRYDYGKYYASKTFFDDQKNRRILLGWVNESSTVADDIKKGWSGIHTIPRAIWLHK
SGKQLVQWPVVEVEKLRVNLVNLPPKVLKGGELLQINGVTAAQADVEISFEVNNIGEAEV
LDNWTDPQILCSQKGSSVKSGLGPFGLLVFASKGLQEFTSVFFRIFRYQHKNLVLFCSDQ
SRSSLNKDNDMTTYGTFIDVDVVHEKLSLRSLIDHSVVESFGGEGKACITARVYPTLAIN
DKAQLYAFNNGTTDVKINRLSAWSMKKAQLNGN
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgaatatctctatttggctattgactctctttactatcatttatggtattcttcctatt
gaagctactcaccatgttttcagaaaccttcaaagtttatcttctcatgattcctccaat
gatcaaccttatagaacttcttatcatttccaacctcccaaaaattggataaatgatcct
aatggaccaatgagttacaaaggactttatcatctattctatcaatacaatcctaaaggt
gcagtttggggaaatattgtgtgggcacattcagtatcaactgatcttattaactggacc
ccactagatcaagccatctctccatctcaaccgtccgatataaatggttgttggtcagga
tcaaccacaatacttaatggtaccaaaccagcaattttgtacactggaattgaccaattt
aaccaccaagttcaaaatttggcctaccccaaaaatttatctgacccttttcttagggat
tggattaagtcaaaaaaaaatccagtaatggaaccaactagtattaatatgattaatgca
agttcatttagggacccaactagtggttggttaggaaaagatggacattggagggtaatt
gttggtagcaaaagggacactaggggaattgcaattttatataggagtaaagattttatt
aattggattgaagctaaacaccctttgtattcatctaagggcactggaatgtgggagtgt
cctgatttttatcctgttttgaaatttagttcaattggtgttgacacatcattgaataat
gatgatgttaggcatgtgttgaaggttagtttggatgataaaaagcatgattattatctt
attgggagttatgatgatggaaaagacaattttgtccctgataaagggtttcagaatact
agtgaattttttttgagatatgattatggaaaatattatgcctcaaaaactttctttgat
gatcaaaagaatagaaggattttgcttggttgggtcaatgaatcatcaactgttgctgat
gatatcaagaaaggatggtctggaatccatacaattccaagggctatttggttgcacaag
tcaggcaaacagttggtacaatggccagttgtggaagttgagaagctaagagtaaatctt
gtcaacttgccccccaaagttctcaagggaggtgaattgctgcaaattaacggtgtcaca
gcagcacaagctgatgttgaaatttcatttgaagtgaataacattggagaggctgaagtt
ttggacaattggacagaccctcaaattctgtgtagccaaaagggttcatcagtaaaaagt
ggtttgggaccctttggtctattagtttttgcttcaaaggggttgcaagagttcacatca
gtgttctttagaatattcagataccaacacaaaaatttggtgctcttttgcagtgaccaa
agcaggtcttccttgaataaagataatgacatgaccacttatgggacttttatagacgtg
gatgttgttcacgagaagctgtcattgagaagtttgattgatcactctgtggtagagagt
tttggaggagaaggaaaagcatgcatcacagccagagtttatccaacattagccatcaat
gataaagcacaactttatgctttcaataatggaactactgatgtcaagatcaacagattg
agtgcttggagcatgaagaaagcacagttaaatggaaattaa

DBGET integrated database retrieval system