KEGG   Cicer arietinum (chickpea): 101512763Help
Entry
101512763         CDS       T02819                                 

Definition
(RefSeq) 7-dehydrocholesterol reductase
  KO
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    101512763
Enzymes [BR:cam01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     101512763
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Ca6
AA seq 436 aa AA seqDB search
MGESKNDTVHSPIVTYFSMISLLTLCPPFVILLWYTMTAADGSILRTFDYLINNGLNGFV
DLWPKPTLLACKIIGVYAVFEAALQLFLPGHTVYGPISPSGNRPVYKANGVAAYLVTLVT
YVVLWWFGIFNPTIVYDHLGEIYSTLIFGSFIFCIFLYIKGHLAPSSTDSGSSGNIIIDF
YWGMELYPRIGKYFDIKVFTNCRFGMMSWAVLALTYCIKQYEENGKVADSMLVNTTLMLV
YVTKFFWWEAGYWNTMDIAHDRAGFYICWGCLVWVPSIYTSPGMYLVNHPVNLGIQLALF
ILVAGILCIYINYDCDRQRQEFRRTNGKGSVWGKAPSKIEASYTTTSGETKRSLLLTSGW
WGLARHFHYVPEILAAFFWTVPALFNHFLPYFYVIFLTILLFDRAKRDDDRCRSKYGKYW
KLYCDRVPYRIIPGIY
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgggggaatcgaaaaacgacaccgttcattctccaattgtgacctatttttccatgata
tcacttctcacactatgtcctccttttgttattctactatggtatacaatgactgctgca
gatggatcaattttgcgtacatttgattacttgattaataacggcttaaacggctttgtt
gatttatggcctaagccgactcttcttgcatgcaaaatcattggagtttacgccgttttt
gaagccgcgcttcagcttttccttcctggtcacactgtttatggtcctatttctccctcc
ggtaatcgacctgtttacaaggcgaatggtgttgctgcatatttagtcaccttggttact
tatgttgttctttggtggtttgggatattcaacccaacaatcgtttatgatcatttggga
gagatatactcaacactcatctttgggagctttatcttttgtattttcttatacataaaa
ggtcatttggcaccatcttctactgattctggctcatctgggaacataatcattgatttt
tactggggtatggagctctatccacgcattggaaaatattttgacataaaagttttcaca
aactgcagatttggaatgatgtcatgggctgttcttgcacttacctattgcataaagcag
tatgaagaaaatgggaaagtagctgactcaatgcttgtaaataccacactgatgctggtg
tatgttaccaagtttttctggtgggaagctggatactggaacacaatggatattgctcat
gatcgagctggattttatatttgctggggctgtttggtttgggttccatctatttataca
tctcctggaatgtaccttgtcaaccatccagtaaatcttggcatccagctagcgctcttt
attttagtggcaggcattctgtgcatatacatcaactatgattgtgacaggcagaggcaa
gagtttcgtaggacaaatggaaaaggctcggtatggggaaaagctccatcgaagatagag
gcctcatatactactacttctggggaaacaaaaagaagccttcttttaacatctggatgg
tggggattagctcgtcattttcattatgtccccgaaatactagctgcattcttctggaca
gtcccagctctttttaatcattttttgccttacttttacgtgatatttcttaccatcctt
ctttttgatcgagcaaaaagagatgatgatcgatgcagatccaagtatggcaagtactgg
aaactctattgcgacagggtaccttacagaatcattccaggaatatattga

DBGET integrated database retrieval system