KEGG   Cicer arietinum (chickpea): 101513899Help
Entry
101513899         CDS       T02819                                 

Definition
pectinesterase 4-like
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101513899
   00500 Starch and sucrose metabolism
    101513899
Enzymes [BR:cam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     101513899
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca3
AA seq 575 aa AA seqDB search
MNAKIIISAVSLILVVGVAIGVVVAVNKKGEDPEIQTQQRSLRVICENAEDQKLCHETLS
SVRGLDAADPKAYIAAAVKATTDSVIKAFNMSDRLTTEYGNKDSGVKMALDDCKDLLEFA
LDSLELSNNLVRDNNIQSLQYQSPDMRNWLSAVISYQQSCMEGFNSENEGEKKIKEQLQV
QGLDRVQKITGVALDIVSGLSKILEQFNLKFDLKPASRRLLAEDTDEEGYPTWFSASDRK
LLGQLQGKGWRSRVTPNVVVAKDGSGQFKTIKDAIASYPKGNKGRYIIYVKAGVYDEYIT
VPKEAVNILMYGDGPQKTIVTGSKNFANGVKTMQTATFANTASGFIGKAMTFENTAGPDG
HQAVALRNQGDTSAFVGCHILGYQDTLYVQTNRQFYRNCVISGTIDFIFGTSATLIQHSV
IIVRKPNDNQFNTVTADGTAEKNMATGIVIQDCEIVPEQALYPVRFQIKSYLGRPWKAYS
KTVVMESTIGDFLHPDGWFPWTGSNFENTLYYAEYANTGPGANVQGRIKWKGYHGVISKA
EATQFTAAEFLKAGPKSGTDWLKALHVPHYLGFKN
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaaagataattatctctgctgtttctcttatcctcgtagtaggtgttgccatt
ggcgttgttgtagctgttaataagaagggtgaagaccctgagattcaaactcaacagagg
tctcttagagttatttgcgaaaatgcagaagaccaaaaactttgtcatgaaacccttagc
tctgtccgtggcctcgacgccgctgatccaaaggcttatatagctgctgccgtgaaagca
accactgacagtgtcattaaggcctttaacatgagtgataggctgactaccgagtacggt
aacaaggacagtggcgtcaagatggctcttgacgactgcaaagacttgttggaattcgcg
ttggacagtcttgaactgtccaacaacttggttcgtgacaacaacattcaatctcttcaa
tatcaatcccctgatatgaggaattggttgagtgcagttatctcttaccaacagagttgc
atggaaggctttaacagcgaaaatgaaggtgagaaaaagatcaaggagcaattgcaagtc
cagggtttggaccgcgtgcaaaagatcaccggtgttgctcttgacattgtgagtggtttg
tcgaagatactcgagcagttcaatttgaagtttgatcttaaacctgcatctcgtcgtctt
cttgctgaggatactgatgaagaaggataccctacatggttctctgcatctgatcgcaag
cttttgggtcaactacaaggaaaaggatggagatcacgtgttactccaaatgttgttgtt
gcgaaggatggtagtggtcaatttaaaaccattaaggacgctattgcctcatatcctaag
ggaaacaagggaagatatattatctacgtgaaggctggtgtttatgacgagtacatcact
gttcccaaggaggcagttaacattcttatgtacggtgatggcccacaaaagaccattgta
acaggaagcaaaaactttgctaatggtgtcaagaccatgcaaactgccaccttcgccaat
accgcaagtggattcattggaaaggcaatgacatttgagaacacagccggtcctgatggt
caccaagcagttgcattgagaaaccaaggagatacatctgctttcgttggttgccatata
ttgggttaccaagacacattgtatgttcaaacaaacagacaattctaccgaaactgtgtt
atctctggtaccattgatttcatctttggaacatctgcaacattgatccaacactctgtc
atcatcgtaaggaagcccaacgacaaccaattcaacacagtaacagcagacggaacagca
gaaaagaacatggctactggtattgtgatccaggattgtgagatagtaccagaacaagca
ttgtacccagtgagattccaaataaaatcatacttgggtagaccatggaaggcatattca
aagacagttgtgatggaatcaacaattggtgactttcttcacccagatggttggttccca
tggacaggatcaaacttcgaaaatacattgtactatgcagagtatgccaacacaggacca
ggtgccaatgttcaaggaagaatcaagtggaagggttatcacggagtcattagcaaggct
gaggctacccaattcactgctgctgaattccttaaggctggacccaaatctggaactgac
tggttgaaggctcttcatgttcctcactaccttggcttcaagaattaa

DBGET integrated database retrieval system