KEGG   Cicer arietinum (chickpea): 101514040Help
Entry
101514040         CDS       T02819                                 

Definition
1,4-alpha-glucan-branching enzyme-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101514040
Enzymes [BR:cam01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     101514040
Exosome [BR:cam04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101514040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca5
AA seq 848 aa AA seqDB search
MISSLSFNPLISSSLNIGCIIHTSKNKQQLAKQKPVELALGYQNPNGCKVFGFESRGSIF
ERVSSGFKRIAVMTDGTSTLSSVEEDFENIGILHVDSSLKPYKNHFKYRLKRYLDQKRLI
EEYEGGLEEFAKGYLKFGFNREEGGILYREWAPAAQEAQIIGDFNGWDGSNHHMEKDQFG
VWSIKIPDADGNPAIPHNSRVKFRFKHSGVWVDRIPAWIKYATVDPTRFAAPYDGVYWDP
PLSERYQFKYPRPPKPKAPRIYEAHVGMSSSEPRINSYREFADDILPRIRENNYNTVQLM
AVMEHSYYASFGYHVTNFFAVSSRSGTPEDLKYLIDKAHSLGLHVLMDIVHSHASNNVTD
GLNGFDLGQSSQESYFHTGDRGYHKLWDSRLFNYANWEVLRFLLSNLRWWLEEFKFDGFR
FDGVTSMLYHHHGVNLAFTGDYNEYFSEETDVDAVVYLMLANCLVHNILPDATVIAEDVS
GMPGLGRPVSEVGIGFDYRLAMAIPDRWIDYLKNKKDNEWSMKEISSNLTNRRYTEKCVS
YAESHDQAIVGDKTIAFLLMDKEMYSSMSCLTDPSPTIDRGIALHKMIHFITMALGGEGY
LNFMGNEFGHPEWIDFPREGNGWSYEKCRRQWNLVETNHLRYKFMNAFDRAMNLLDDKFS
ILASTKQIVSSTNNEDKVIVFERGDLVFVFNFHPDNTYEGYKVGCDLPGKYRVALDSDAR
EFGGHGRVGHDADHFTSPEGIPGVPETNFNNRPNSFKVLSPPRTCVVYYRVDESHEENNS
TNVGVVEETFAAADTDLSTESEDSNLDQIEENLEDAVVPKVKVESKDVETNSKTHTKWKK
TQTKWKRT
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgatttcctctctgagttttaatcctctcatttcttcctctttaaacattggctgcatc
attcacacctcgaaaaataagcagcaacttgccaagcaaaagccagtagagttggccctg
ggctatcagaatccaaatggatgcaaggtgttcggttttgaatcaagaggatcaatattt
gagagggtgagctctggtttcaaacgcatagccgttatgacagatggcacatcaacattg
tcatccgttgaagaagactttgaaaacataggcatcttgcatgttgattcatccctaaaa
ccatacaaaaatcacttcaaatatagactgaagagatatctagatcagaaaaggctcatt
gaagaatatgaaggaggtcttgaagaatttgcaaaaggttatttgaaatttggatttaac
agagaagaaggtggcattttgtaccgtgagtgggcacctgctgctcaggaagcacaaatt
attggggactttaatgggtgggatggttccaaccatcacatggaaaaagatcaatttggt
gtatggagcattaagatccctgatgctgatggaaatccagctatacctcataattcaaga
gtaaagtttaggttcaaacatagtggagtttgggttgatcgcatccctgcttggattaaa
tatgccactgttgatcctaccagatttgctgcgccatacgatggtgtctactgggatcca
ccactttcagagaggtatcagtttaaatatcctcgtcctccgaagccaaaagctccacgg
atatatgaagctcatgtgggaatgagtagctctgaaccccgcataaactcttaccgggaa
tttgcagatgatattttgccacgtattcgggaaaataactataatacagttcagctgatg
gctgtgatggagcattcttattatgcatcatttggatatcatgtaacaaacttttttgct
gtgagcagtagatctggaacccccgaagatcttaaatatctgatcgataaggcacatagc
ctgggtttgcatgttttgatggatattgtccatagtcatgctagtaataatgttactgat
ggactcaatggctttgatttgggccaaagttcacaagaatcttacttccacaccggagat
agaggctatcacaaactatgggatagcagactttttaactatgccaactgggaagttctt
cgtttccttttatctaatttaaggtggtggcttgaggagttcaaatttgatggatttcga
tttgatggagtgacatcaatgctgtaccatcatcatggagtcaacctggcatttacaggg
gattataatgaatattttagtgaagaaacagatgtggatgctgttgtctatttgatgttg
gctaattgtctagtccataatattttgccagatgcaactgtcattgctgaagatgtttct
ggcatgcctggactcggccgaccagtttctgaggtgggaattggttttgactatcgacta
gccatggctatccctgacaggtggattgactacttgaagaacaaaaaagacaatgagtgg
tcaatgaaagaaatctcttcaaatttgacaaataggagatacactgagaaatgtgtctcc
tatgctgaaagtcatgaccaagccattgttggggacaaaactattgcatttttactaatg
gataaagaaatgtattctagcatgtcttgtttgactgatccttctcccactattgaccgg
gggattgctcttcacaagatgatacacttcataaccatggcattaggcggagaaggctac
cttaatttcatggggaatgagtttggccatccggaatggattgatttcccaagagaaggc
aatggatggagttatgagaagtgcaggcgtcagtggaatctggtggagacaaatcacctg
agatacaagttcatgaatgcatttgacagagcaatgaacctgcttgatgataaattctca
atccttgcatcaactaaacaaattgtgagcagcacaaacaatgaagacaaggttatagtc
tttgaacgtggggatctggtgtttgtgttcaatttccatccagataatacatacgaaggg
tataaagttgggtgtgacttgccagggaaatacagagttgcactggatagtgatgcacgg
gaattcggaggacatggaagagtgggacacgatgcagatcacttcacatccccagaaggc
ataccaggagttcctgaaacaaatttcaataaccggcccaattccttcaaggtcctttca
ccccctcgtacctgtgtggtatattatagagtggacgaaagccacgaagaaaacaacagt
acaaatgtgggtgtggttgaagagacatttgctgcagcagatactgatctttctacggaa
agcgaagatagcaatttggatcagatagaagagaacttagaagatgcagttgttcccaaa
gttaaggttgaaagtaaagatgttgaaacaaattcgaagacgcatacaaaatggaagaag
acgcagacaaaatggaagagaacttag

DBGET integrated database retrieval system