KEGG   Cicer arietinum (chickpea): 101514559Help
Entry
101514559         CDS       T02819                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase
  KO
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101514559
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101514559
Enzymes [BR:cam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     101514559
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Ca4
AA seq 960 aa AA seqDB search
MVTGNIFHCRKNSWPTEEYISKSTLQLFDLDSAAPPEQAWRRRLNSHANLLKEFRVTFTE
AIKMVRLGIRMWSYVREEASHGRKAPIDPFTRESCKPSASQGVPLGGMGSGSISRGFRGE
FRQWQIVPGVCEPSPVMANQFSIFVSRDGGNKSFASVLAPGQHEGLGSSRKADEQGISSW
GWNLNGQHSTYHALFPRAWTVYDGEPDPELKISCRQISPFIPHNYRESSLPAAVFVYTLV
NTGKERAKVSLLFTWANSIGGDSHLSGDHVNEPFIAEDGVSGVLLYHKTAKDNPPVTFSI
AACETQNVSVSVLPCFGLSEGSSVTAKEMWSKMVKDGQFDRENFSSGPSMPSSPGETLCA
AVSASAWVEPHGKCTVAFSLAWSSPKVKFVKGSTFHRRYTKFYGASDGAAVDLAHDALTY
YKRWEEEIEKWQNPILKDESLPEWYKFTLFNELYFLVAGGTIWIDTPLLSSNMKNSQQDQ
VKESENAVVGITESHNHVDEKNYRDISHENGSANTLIKGNFTDTRYSSTMKNLQYDDDND
DAGRFLYLEGVEYVMWCTYDVHFYASFALLMLFPRIELNIQREFAQAVLCEDGRKVKFLA
EGNWGIRKVFGAVPHDLGMHDPWHEMNAYNIHDTSKWKDLNPKFVLQVYRDFAATGDLQF
GVDVWPAVRAAMEYMEQFDRDADGLIENDGFPDQTYDTWTVHGVSAYCGGLWLAALQAAA
AMAIELGDRDFAETCKRKFLKAKPVFEQKLWNGSYFNYDSGSSGNSKSIQADQLAGQWYT
SSSGLPSLFDDFKIKSSLQKVFDFNVMKVKGGRMGAVNGMHPSGKVDETCMQSREIWTGV
TYGVAATMILAGMEEEAFKTAEGIFLAGWSEDGYGYWFQTPEAFTIDGHYRSLIYMRPLS
IWGMQYALTLPKAVLEAPKINFMDRIHLSPVSGGFPHNEPGVRKIAKTKCFSNSVFHCAC
NT seq 2883 nt NT seq  +upstreamnt  +downstreamnt
atggttaccggcaacatttttcattgtagaaagaattcgtggcctactgaagagtatatc
agtaaatccactttacagttgtttgatttggatagtgctgctccgcctgaacaagcttgg
agaaggagattaaatagtcatgccaatcttcttaaagaatttagagtaacttttacggaa
gctataaagatggttcgtttaggtatacgcatgtggtcatatgttagggaagaggcttct
catggaaggaaagcacctatagatcctttcactcgagaaagttgcaagccatctgcatct
caaggggttccacttggagggatggggagtggcagcatatcaagaggatttagaggtgag
ttcagacaatggcaaatcgttcctggtgtatgtgaaccatcacctgtcatggccaaccag
ttctctatttttgtcagtagagatggaggaaacaaaagtttcgcatcagttttggctcct
ggacagcatgaaggtttaggatccagcaggaaagctgatgaacagggtatatcatcatgg
ggatggaatctaaatggccagcactcaacttatcatgctttgtttccaagagcttggacc
gtttatgatggtgagccagacccagaactaaaaatatcatgccggcagatatcccctttc
ataccacataattacagagaaagcagtctacccgcagctgtttttgtctatacgttggta
aacactggcaaggaaagagctaaagtcagccttttatttacttgggcgaattccattggt
ggagactctcacttgtcaggagatcatgtgaatgaaccattcatagctgaagatggtgtc
tccggagtacttctatatcacaagacagcaaaagacaaccctcctgtgactttttctatt
gctgcatgtgagacacagaatgttagtgtttctgttttgccatgttttgggctgtctgaa
ggaagtagcgtaacagcaaaagaaatgtggtctaaaatggtgaaggatggacaatttgac
cgggaaaatttctcttctggacccagcatgccctcatcccctggagagacactatgtgct
gctgtttcagcttctgcatgggtagaacctcatggaaaatgtactgttgcatttagtctt
gcatggtcgtctcctaaagtaaagtttgtgaaaggcagcactttccacaggagatataca
aaattttatggggcttctgatggagctgcagtggacttggctcatgatgcactgacatat
tataaacggtgggaagaagagattgagaaatggcagaatcctattcttaaggacgagtcg
ctacctgaatggtacaagtttacattatttaatgaactctactttcttgttgctggagga
acaatttggattgacactcctttgctgtcttcaaatatgaagaatagccaacaagatcag
gtaaaagagtcagaaaatgcagtagtcggaataactgaatcccataatcatgtggatgaa
aaaaattatagagatatatcccatgaaaatggatctgcaaacactctcataaaaggaaac
ttcactgacactcggtattcttcaacaatgaagaacctacaatatgatgatgataatgat
gatgctgggaggttcttgtacttggaaggtgtagaatatgtcatgtggtgcacatatgat
gtgcacttctatgcttcatttgcgcttcttatgctctttcctcgtattgaattaaatata
cagcgtgagtttgctcaagctgtcctgtgtgaagatggaagaaaagtaaagtttctggca
gagggaaactggggaattcgtaaggtgtttggggctgtcccacatgatttggggatgcac
gatccatggcatgaaatgaatgcttataacattcatgatactagtaagtggaaggacctt
aacccaaaatttgtacttcaggtgtatcgagattttgctgcaacaggtgatttgcaattt
ggagtcgatgtgtggcctgcggtccgtgctgcaatggagtacatggaacaatttgataga
gatgcggatggtcttattgagaatgatggtttccctgatcaaacatacgacacatggaca
gtccatggtgtaagtgcttactgtggtggtctttggcttgctgctcttcaagctgcagct
gcaatggccattgaactaggtgacagagattttgcggaaacatgcaaaaggaagtttctg
aaggctaagccagtatttgaacaaaagctgtggaatggttcttattttaactatgacagc
ggatcaagtggtaacagtaaatccattcaagccgatcaattggctgggcaatggtataca
tcatcctcagggttgccctctcttttcgatgatttcaagatcaaaagttctctccagaag
gtttttgatttcaatgtgatgaaagttaaaggaggcaggatgggtgctgtaaatggcatg
catcccagtggtaaggtggatgaaacttgtatgcagtctcgagaaatatggacgggtgta
acctacggtgtcgcagcaacgatgatacttgcaggaatggaagaggaggccttcaaaact
gctgagggtatatttctagcaggctggtcagaagatggatacggatactggtttcagact
ccagaggcattcacaattgacgggcattaccggtccctcatatatatgaggccactgtca
atttggggtatgcaatatgcattaactctgccaaaggcggtacttgaggcccctaaaatt
aacttcatggacagaatccacctatctcctgttagtggaggattccctcataacgaacca
ggtgtgagaaagattgcgaaaacaaaatgctttagcaattctgtgtttcattgtgcttgc
tga

DBGET integrated database retrieval system