KEGG   Cicer arietinum (chickpea): 101514774Help
Entry
101514774         CDS       T02819                                 

Definition
protoporphyrinogen oxidase, chloroplastic-like
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cam  Cicer arietinum (chickpea)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cam00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    101514774
Enzymes [BR:cam01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     101514774
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Ca4
AA seq 558 aa AA seqDB search
MVTLTLFNDLPFPPTQTLLRPSLHSPFHFSSPIPISKFLRNHHNPILRLRCSIAEESTAS
PTKTASNSGSVARGHSPVDCVVVGGGISGLCIVQALSTKHANVAPNVIVTEARDRVGGNI
ITVERDGYLWEEGPNSFQPSDPMLTMVVDSGLKDELVLGDPDAPRFVLWNGKLRPVPGKP
ADLPFFDLMSIGGKLRAGFGALGIRPPPPGYEESVEEFVRRNLGDEVFERLIEPFCSGVY
AGDPSKLSMKAAFGKVWRLEQNGGSIIGGSFKALQEKNGATKPPRDPRLPKPKGQTVGSF
RKGLTMLPEAISARLGSKVKLSWKLLSVSKLDSGEYSLTYETPEGVVSLQSKTVVMTIPS
HVASTLLRPLAPTAADALSKFYYPPVAAVSISYPKEAIRSECLIDGELKGFGQLHPRSQG
VQTLGTIYSSSLFPNRAPPGRVLLLNYIGGATNPGILSKTESELVEAVDRDLRNILINPN
APDPLFLGVRLWPQAIPQFLIGHLDLLDAAKVSLKSTGFEGLFLGGNYVTGVALGRCVEG
AYEVAAEVNDFLSQRVYK
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggtcacacttaccctcttcaacgacctcccattcccacccactcaaacccttctccgc
ccctctctacattctccatttcatttctcctcgccaattccaatatctaaattccttcgc
aatcaccataaccctattctccgcctccgctgctcaattgcagaggaatctaccgcgtct
ccgaccaaaaccgcctcaaattccggttccgtcgccagaggccattcacctgttgattgt
gttgtcgtaggcggtggtatcagtggcctctgcatcgtccaggctctttccaccaagcac
gccaatgttgctcccaacgttatcgtcaccgaggctcgagatagagttggcggcaatatc
atcaccgttgagagggatggttacctctgggaagaaggtcctaacagttttcagccatct
gatcctatgctcaccatggtggtagacagtggtttgaaggatgaacttgttctgggagat
cctgatgcgcctagatttgtgttgtggaatgggaaattgagaccggtgccgggaaagccg
gctgatttgcctttctttgacttaatgagcataggtggcaagctcagagctggctttgga
gcacttggaattcgccctcctcctccaggttatgaggaatcagttgaagaattcgtgcgt
cgtaatcttggtgatgaggtttttgaacgcttgatagagcccttttgttcaggtgtctat
gctggtgatccttcaaaattaagtatgaaagcagcattcgggaaagtgtggagactggaa
caaaatggtggtagcattattggtgggtctttcaaagcattacaagagaaaaatggagct
actaaaccacctcgtgacccgcgtctgccaaaaccaaagggtcaaactgttgggtctttc
aggaagggacttaccatgttgccagaagcaatttctgctaggttaggtagcaaggtgaaa
ttatcttggaagcttttaagtgttagtaaactggatagtggagagtacagtttgacatat
gaaaccccagaaggagtcgtttctttgcagagcaagactgttgtcatgaccattccttcc
catgttgctagtacattgctgcgtcctctggctcctactgccgcagatgcactttcaaag
ttttattaccctccggttgctgcagtttccatttcctatccaaaagaagccattagatca
gaatgcttgatagatggcgagttgaaggggtttggtcaattgcatccacgttcccaagga
gtgcaaacattaggaactatatacagctcttcacttttccctaaccgagcaccacctgga
agggttctgctcttgaattatattggaggggctaccaatcctggaattttatcaaagacg
gagagtgaacttgttgaagcagttgatcgagatttgagaaatattctcataaacccaaat
gctccggatccgctttttttgggggtgagactgtggcctcaagctattccacagttctta
attggacatcttgatctcctagatgctgctaaagtgtctctaaaaagtactgggtttgag
gggttgttccttgggggcaactatgtgactggtgttgccttgggacggtgtgtcgaggga
gcctatgaggtagcagctgaagtaaatgattttctctcgcagagagtgtacaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system