KEGG   Cyanobacterium aponinum: Cyan10605_0232Help
Entry
Cyan10605_0232    CDS       T02376                                 

Definition
DNA-(apurinic or apyrimidinic site) lyase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
can  Cyanobacterium aponinum
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:can03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(291935..292768)
Genome map
AA seq 277 aa AA seqDB search
MPELPEVETVCRGLNYVTSGLVIMGADVLLSRSVAFPDSDSTFVQEVKSQKILQWHRRGK
YLLAQLSEGYLGVHLRMTGQLLWVKQDSPLQKHTRVRFFFADNQELRFVDTRTFGKVWLV
NQDVAPDSIITGLQKLGYEPFDAQFSVTYFQDKLKRCRRPIKTVLLDQGIVAGIGNIYAD
EALFVSNIHPQTLACDLSSSQIERLHSAILEVLETAIASGGTTFSDFLHITGVNGNYGGK
AWVYGRKGQPCRICSNIIEKIKLGGRSSHFCPQCQKG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacctgaagtagaaactgtgtgtcggggtctcaattatgtgacctcggga
cttgttattatgggggcagatgtcttgctgtctcgtagtgtggcttttcctgattctgac
tctacatttgtacaggaagttaagtcacaaaagattttacaatggcatcggagaggaaag
tatttattagcccaattatccgaaggttacttaggagtccatttgaggatgacagggcag
ttattatgggttaaacaagattctcctttgcagaaacatacaagggtaagattctttttt
gctgataatcaagagttacgttttgtggatacgaggacttttggcaaggtgtggttagtt
aatcaagatgttgcccccgattctattatcactggtttgcaaaagttgggttatgagcct
tttgacgctcaattttccgttacttattttcaggataaattaaaacggtgtcgtcgcccg
attaaaacggtgcttttagatcaaggtattgtagcgggtattggtaatatttatgctgat
gaggcgttatttgtcagtaatattcatcctcaaacccttgcctgtgatttgtcttcatcc
caaatagaaaggttacactctgctattttggaggtgttagaaactgcgatcgcatctggg
ggaacaacatttagtgattttctccacattactggggttaacggtaactatggcggaaaa
gcatgggtttatggtcgtaaagggcaaccctgccgtatatgttctaatataatcgaaaaa
ataaaattaggagggcgatcgagtcatttttgccctcaatgtcaaaagggataa

DBGET integrated database retrieval system