KEGG   Cyanobacterium aponinum: Cyan10605_0322Help
Entry
Cyan10605_0322    CDS       T02376                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
can  Cyanobacterium aponinum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:can00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cyan10605_0322
Enzymes [BR:can01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Cyan10605_0322
Exosome [BR:can04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cyan10605_0322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(416213..418159)
Genome map
AA seq 648 aa AA seqDB search
MVMAQTRQQDWFSEVDLYLFGEGTHYRIYEQLGAHLTERDGKSGVYFAVWAPNAQNVSLV
GDFNNWQAEHTNMKRNMMGIWEIFMPGMKEGEKYKYAVKNHHGYNCFKTDPHGFEQEIRP
ATASIVRDISYTWGDRTWLTQRQENHSYEKPISVYEVHLGSWMHENIENPPENGVIVPVP
DKQGARFLTYRELADRLIPYVKDMGYTHIELMPITEHPFDGSWGYQVVGFFAPTSRYGSP
QDFMYFVDRAHQEGIGVLIDWVPGHFPKDEHGLARFDGTHLYEYSDWRKGEHLEWGTLVF
NYERNEVRNFLIASALFWLEKYHIDGIRVDAVASMLYLDYEREVWVRNQYGGRENIEGID
FIRQLNNAIKENYPGVLTIAEESTTWENVSQPTKYGGLGFDYKWNMGWMNDTLKYFLAHP
HDRPNFHNKLTFSMWYAFTEHFMLSLSHDEVVHGKGHLWQKMPGDEWQQMANMRLLFGYM
FAHPGKKTLFMGMELGQRREWKYFLDLDWWLLEWQPHRQLQQLVKDLHILYRSQPALYTD
DFTHDGFQWIDCHDAGRSMLTFMRRDKNTHEVLVVVCNFKPDVYYHYWLGVNEAGTYEEI
MNTDDLKYGGSGVVNQKVKTKDWNHCPWPYALEITVPPLSMTMFKKVK
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggttatggcacaaacaaggcaacaagactggtttagtgaggttgatctatacttattc
ggcgaaggaactcattatcgaatttatgaacagttaggagctcatctcactgaaagagat
ggtaaatcaggggtttattttgctgtatgggctcccaatgctcaaaatgtctctttagtg
ggagattttaataactggcaagcagaacataccaacatgaaacgcaatatgatgggcatt
tgggaaatatttatgcccggaatgaaggaaggagaaaaatataaatatgcagtcaaaaat
catcatggttataattgctttaaaacagacccccatggctttgaacaagagattcgccct
gccactgcttctattgttagagatatatcctatacatggggcgatcgcacttggttaact
caaagacaggaaaaccactcctacgaaaaacctatctctgtatatgaagtccatttaggc
tcatggatgcacgaaaatattgaaaatccccccgaaaatggtgttatcgtaccagtacct
gataaacagggtgcaagatttttaacctaccgagaattagccgatcgcctcatcccctac
gtgaaagacatgggctatacccacattgaattaatgcccattaccgaacatcccttcgat
ggttcatggggttatcaagtagtcggcttttttgcccctacttcccgttatggaagccct
caagattttatgtatttcgttgatcgcgcccaccaagaaggtatcggggttttgattgac
tgggtgccggggcattttcccaaagatgaacatggattagcccgttttgacggtacacat
ttatatgaatattccgactggcgtaaaggggaacacttagaatggggtacattagtattt
aactatgaacgtaacgaagtccgtaacttcttaattgccagtgccttattctggttggaa
aaataccacatagacggcattcgagtggatgcagtggcttccatgctttaccttgactat
gaaagagaagtttgggtaagaaaccaatacggaggcagagaaaacatcgaaggaatcgac
tttattcgccaattaaacaacgctatcaaagaaaactaccccggagttttaactatcgct
gaagaatccactacctgggaaaacgtctcacaaccaacaaaatacggcggtttaggcttt
gattataaatggaatatgggttggatgaacgacactttaaaatatttccttgcccatccc
cacgatcgccccaacttccacaataagttaacatttagtatgtggtacgcttttaccgaa
cactttatgttatccctctctcacgatgaagtagtccacggtaaaggacacctatggcaa
aaaatgccgggggatgaatggcaacaaatggcaaatatgcgcctattgtttggttatatg
ttcgctcaccccggtaagaaaaccctctttatgggtatggaattaggacaaagacgggaa
tggaaatattttctcgatctcgactggtggttattagaatggcaacctcatcgccaacta
cagcaattagtcaaagatttacatatcttataccgcagtcaacccgctctttataccgat
gatttcacccatgacggatttcaatggattgattgccatgacgcaggacgcagtatgctt
acctttatgcgtagagacaaaaacactcacgaagttttagtggtagtgtgtaacttcaaa
cccgatgtttactatcactattggttaggagtgaatgaagcaggtacttatgaagaaatt
atgaatactgatgatcttaaatatggtggtagtggagtagtaaatcaaaaagtgaaaact
aaagattggaatcattgcccctggccttatgctttagaaataacagttccgcccctatcc
atgactatgtttaaaaaagttaaataa

DBGET integrated database retrieval system