KEGG   Cyanobacterium aponinum: Cyan10605_0467Help
Entry
Cyan10605_0467    CDS       T02376                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
can  Cyanobacterium aponinum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:can00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cyan10605_0467
Enzymes [BR:can01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Cyan10605_0467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
596221..597039
Genome map
AA seq 272 aa AA seqDB search
MSNYRESYPLAGETILITRAYQSGNSFRQMLEAKGATVLEMPALEIKPPSSWQPLDKAIN
HIADFHWLILTSANGVEYFLERLHHLGKDINYLKNLKIAVVGKKTAHFLEKYNISPDFIP
PDFIADSLVTHFPESIEGKKILFPRVETGGREILVQELTQQGGEVVEIPAYQSTCPDTID
NTVWDALVKEVISIITFASSKTVRNFHYLVTQALQTTPQLTLSSLLTEVAIASIGPQTSM
TCQELLGKVDIEAQEYTLEGLVDSLVKKQYTS
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtccaattatcgagaatcatatcccttagcaggagaaacaattttaattacccgtgcc
tatcaaagtggaaatagttttcggcaaatgttagaagccaaaggggcgacagttttggaa
atgccagctttggaaattaaacctccctctagttggcaacccctagataaagcgattaat
catattgccgattttcattggttaattcttacttctgctaatggggttgagtatttcttg
gaaaggttacatcatcttgggaaggatattaattatctcaaaaacttaaaaatagctgtg
gttggcaaaaaaactgctcattttttggagaaatataatatatctcctgactttatccct
cctgattttatcgctgattctctagtgactcattttcctgaaagtattgagggcaaaaaa
attctatttcctagggtagaaacgggaggtagagaaattttagtacaagaattaactcaa
caagggggagaagttgtggaaatacccgcttatcaatccacttgtcctgataccatagat
aatacagtatgggacgctttagtaaaagaagttattagtattatcacctttgctagttca
aaaaccgtccgtaattttcattatcttgtgactcaagccttacaaacaactccccagtta
actttatcatcattattaacagaagttgcgatcgcatctataggtcctcaaacatctatg
acttgtcaagaattattaggtaaagttgatattgaagcccaagaatatactctggaagga
ttagttgattctctggtgaaaaagcaatacacctcataa

DBGET integrated database retrieval system