KEGG   Cyanobacterium aponinum: Cyan10605_0719Help
Entry
Cyan10605_0719    CDS       T02376                                 

Definition
cobaltochelatase (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
can  Cyanobacterium aponinum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:can00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cyan10605_0719
Enzymes [BR:can01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cyan10605_0719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(883833..887720)
Genome map
AA seq 1295 aa AA seqDB search
MKRIVLITGFETFNSGLYRQSATLATSRCEGLEVIVFTDADINTQRENIESALQTADVFF
ASLLFDYDQVMWLREKVSHIPIRLVFESALELMSLTQIGKFAIGDKPKGMPKPVQFILSK
FTNSKEEDKLAGYISFLKTGPKLLKYIPVKKVQDLRNWLIIYGYWNAGGVENVASMCWYL
AENYLGLKVSEIPPVIETPNMGLLHPDYESYFTSPSEYLSWYQGREKKNPPLSPLNRGEV
TDDKDITHLSKGGRGGYPVVGILLYRKHVISKQPYIPQLIRYFEEAGLIPLPIFINGVEG
HVAVRDWMTTDYEQEKRSQGINETPSLSKDAVKVDAVISTIGFPLVGGPAGSMEAGRQVE
VAKRILTAKNIPYIVAAPLLIQDIYSWVRKGIGGLQSVVLYALPELDGAIDTIPLGGLVG
EDIYLIPERVKRLTGRVNNWIKLRRKQKCDRKIAIILYGFPPGYGATGTAALLNVPKSLH
KLLNALKEEGYTVDSIPEDGEEIINQVKTADDFISYSSPPFIPPQEVGNIQDKNSTPNSP
LYKGGRGVSNTVDVKTLDRWLGYILINKIQKQWGNLTQTGIKTIGDKFQIGGIQLGNVWI
GVQPPLGVAGDPMRLMFEKDLTPHPQYTAFYKWLQNDFQADAIIHFGMHGTVEWLPGNPL
GNTGYSWSDVLLGDIPNLYIYAANNPSESMLAKRRGYGVLISHNVPPYGRAGLYKELMAL
KELINEYREDNEKNALLKEDIIQKIVDSGLNKDCKFAEGEKLGIEFTAENAKLFSKQALN
AYFVQIYDYLQIVEQRLFSSGLHILGEKPTPEQLQSYLEAYFDDTYSQQNFAQELSNSDL
FARVEKKAEKEEELKQRFAQQQLITDLLMQTEDELTNLLRGLNGEYIPPAPGGDLLRDGA
GVLPTGRNIHALDPYRMPSQGAYLRGREIGKKIIEQNLAENGCYPETVAVMLWGLDAIKT
KGESIGILLELVGAQPVKEGTGRIVRYELVPLEEVGHPRIDVLGNLSGIFRDTFLNIIEL
LDDLFYRASIIDESPENNFIRKHYLELKEKDIDNASARLFSNPNGDFGSLVNDQVVDGNW
DSGDELADTWKNRNVFSYGRKDKGETRPEILDKLLQTSATVVQEIDSVEYGLTDIQEYYA
NTGGLKRAAEKQSGKKVSASFVESFSKDTTPRKLEQVLRMEYRTKLLNPKWAKAMAEQGS
GGAYEISQRMTALIGWGGTVDFTDNWVYDQAVDTYVLDQDMANKLREANPEAFRNIVGRM
LEANGRGFWDADEEKLEKIKSLYEMTEDELEGVTL
NT seq 3888 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtatagtattaataacaggatttgaaacttttaacagtggcttataccgtcaa
tcagcgactctcgctacatctcgctgtgaaggtttagaagtaatagttttcaccgatgca
gatattaatactcaaagggaaaatatagaatcggctttacaaactgctgatgttttcttt
gccagtctgctttttgactatgatcaagtaatgtggttaagggaaaaagtgagtcatatt
cccattcgtcttgtttttgagtcggctttagagttaatgagtttgactcagataggtaaa
tttgccatcggggataagcccaaagggatgcctaaacctgtacaattcatcttgagtaag
tttaccaatagcaaagaagaagataaactcgcaggatatatcagctttttaaaaactgga
cctaaattattaaagtacattcccgttaaaaaagtccaagatttacgcaactggttgatt
atttacggttattggaatgcaggaggagttgagaatgttgcctctatgtgttggtattta
gcggaaaattatctcggcttaaaggtatcggaaattccccctgttatcgaaactccgaat
atggggttactccatcctgactatgagagttattttacttctcctagtgagtatttgagt
tggtatcaaggaagagagaagaaaaacccacctttatcccccctaaataggggggaagta
actgatgataaagatatcacccaccttagtaaggggggaagggggggttatcctgtggtt
ggtatattgttatatcgtaagcacgttatcagcaaacaaccctatatccctcaattaatt
cgttactttgaagaagccggattaattcctttacctatttttattaatggtgtggaaggt
catgtggctgtaagagattggatgacaacggactatgagcaagaaaaacgtagtcaaggt
atcaatgaaactccctctttatcaaaagatgcggtgaaagttgatgcggtaatctctacc
atcggatttcctttagtgggtggtccggctggtagtatggaggctggaagacaggtagaa
gtggcaaaacgtatcttaacggcgaaaaatattccctacattgtcgccgcgcctttatta
atccaagatatttattcatgggtaagaaagggtatcggtggtttgcaaagtgtggtatta
tacgctttacctgagttggatggtgcgatcgatactatcccattgggtggtttagtgggt
gaagatatatatcttattccagaaagggttaagcgtctcacgggtagagtgaataactgg
attaagttaagaagaaaacaaaagtgcgatcgcaagattgctattattttatatggattc
cctcccggatatggtgcaactggtacagccgcactattgaacgtacctaaatccctgcac
aaacttttaaacgccttaaaagaagaaggctataccgttgatagtatccctgaagacggg
gaagaaatcattaaccaagttaaaaccgccgatgattttatttcctattcttcacccccc
tttatcccccctcaagaggtgggaaatatacaagataaaaattccactcctaactcccct
ctttataaggggggtaggggggtttcaaataccgtagatgtcaagaccctcgatcgctgg
ttagggtatatactaataaataaaatccaaaaacaatggggaaatctcactcaaacaggc
attaaaaccatcggtgacaaattccaaattggcggtattcaacttggcaacgtctggatt
ggagtacaacctcctctaggtgtagcgggagatcccatgaggcttatgtttgagaaggat
ttaaccccccatcctcaatatacagccttttataaatggttgcaaaacgactttcaagcc
gacgcaattatacacttcggaatgcacggcacagtggaatggttgcccggtaatccttta
ggtaatacgggttattcttggtcagatgtactactaggagatattcctaacctctacatt
tacgctgctaacaaccctagtgaatccatgttagccaaaaggagaggctatggtgtgtta
atttctcataatgtaccaccttacggcagggcaggattatataaagagttaatggcatta
aaagagttaattaacgagtatcgagaagataacgagaaaaatgccctcttaaaagaagat
attatccaaaaaatcgttgatagtggcttaaataaagactgtaaatttgctgaaggagaa
aaactaggtatcgaatttactgccgaaaacgccaaattattcagtaaacaggcattaaac
gcttattttgtccaaatatacgactatttgcaaatagttgaacaaagattattctcctct
ggtttacacatcttaggagaaaaacccaccccagagcaactgcaatcctatttagaggct
tatttcgatgatacttatagtcaacaaaacttcgcccaagagttaagcaatagtgactta
ttcgccagagtcgagaaaaaagcagaaaaagaagaagaattaaagcaacgttttgcacaa
caacagctaattactgatttgttaatgcagacagaagatgaattgactaacctactaaga
ggcttaaacggtgaatatatcccccctgcgccgggaggagacttactcagggatggggct
ggagtgttgcctacaggtcgtaatattcacgcattagatccctatcggatgccttctcag
ggtgcgtatttaagaggtagagagattggtaagaagattattgagcagaatttggcggaa
aatggttgttatcctgagactgttgctgttatgctatgggggttggatgccattaaaact
aagggcgaatctattggtattttactagaattagtgggtgcgcaacctgtgaaagaaggt
acagggcgtatagtaagatatgagttagtgccattagaagaagtagggcatccgcgcatc
gatgttttaggcaatttatcgggaattttccgagatacctttctgaatatcatcgaattg
ttagacgatttattttaccgtgcttccattatcgatgaatctcccgaaaataactttatt
cgcaaacattaccttgaattaaaggaaaaagatattgataacgcatctgcacgactattt
tctaatcctaacggtgattttggctcattagtaaatgatcaagttgtggatggtaactgg
gattctggggatgaattagcggatacatggaagaatcgcaatgttttcagctacggaaga
aaggataagggagagacacgccccgaaattctcgataaactattacaaaccagtgcaacc
gttgtgcaggaaatcgactcggtagaatatggtttgacggatattcaagaatattatgct
aacacgggaggtttgaaacgggcggcggagaaacaaagcggtaagaaggtatccgctagt
tttgtggaaagtttctcgaaagataccactccccgtaaattagaacaggttttaaggatg
gaatatcgcacaaaattacttaaccccaaatgggcaaaagctatggctgaacaaggttct
ggcggtgcttatgaaatatcacaacggatgactgctttaattggttggggaggcactgta
gattttaccgataattgggtatatgatcaagctgttgatacttatgtattagatcaggat
atggcgaataagttaagggaagcgaatcctgaagccttccgcaatattgtggggaggatg
ttggaggcgaatgggcgcggtttttgggatgcggatgaggagaagttagagaaaatcaaa
agtctttatgagatgacggaggatgaattagaaggggttacgctatga

DBGET integrated database retrieval system