KEGG   Cyanobacterium aponinum: Cyan10605_0847Help
Entry
Cyan10605_0847    CDS       T02376                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
can  Cyanobacterium aponinum
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:can00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1032701..1033645)
Genome map
AA seq 314 aa AA seqDB search
MQSYSLFAPAKINLHLEIIGDRTDGYHELVMIMQSVNLGDIIHLRANGTDEIRLFCQNPQ
VPLDDTNLAYKAVRLVQEKYPTLSRNYGGIDITIEKNIPVAAGLAGGSSNAAAVLVGLNL
MWNLGLTQPELKDLGALLGSDVPFCISGGTAIATGRGEQIEPLPDLKNLWVILAKYSNIS
VSTGWAYNTYRELFNHEYISNPQEVKQRTHEIHSGNLVKAISKNDYKQIGALLYNDLEKV
VLPEYSAVNELIEAFKSKNVLGAMMSGSGPTVFALCDKKEEAETIMEEVKESINDPNLDC
WLTQVCPHGIMVNQ
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcctattctctttttgcccctgctaaaattaatctccatttggaaattataggc
gatcgcactgacggttatcatgaattagtgatgatcatgcaaagcgttaatttaggagat
ataattcacttaagagccaatggcaccgacgaaattcgcctcttttgtcaaaatcctcaa
gtgcctttagatgatactaatttagcttataaagcagtgcgtttagtacaagaaaaatac
cctaccctcagtcgtaactatggcggaatagacatcaccatcgagaaaaatatccccgtt
gcggcaggattagcaggaggctcaagtaatgctgcggctgtcttagtcgggcttaacctt
atgtggaatttaggcttaactcaaccagaattaaaagatttaggggctttattaggttct
gatgtacccttttgtatttcaggaggaactgcgatcgctactggtagaggagaacaaatt
gagccattacccgatttaaaaaatttgtgggtaatcctcgcaaaatatagtaatatcagc
gtttccacaggatgggcatacaatacttatcgagaactatttaaccatgaatacatctcc
aatccccaagaagtaaaacaacgcacccacgaaatccatagcggtaacttagtcaaagct
atcagtaaaaatgattacaagcaaattggagctttactgtacaatgaccttgaaaaagtc
gttttaccggaatatagtgccgtaaatgaacttatagaggcatttaaaagcaaaaacgta
ttaggagcgatgatgtctggttcaggacccacagtatttgcattgtgcgacaaaaaagag
gaagccgaaacaatcatggaagaagtaaaagaaagtataaatgatcccaacctagattgt
tggttaacccaagtttgtccccatggtatcatggttaatcaatag

DBGET integrated database retrieval system