KEGG   Cyanobacterium aponinum: Cyan10605_1248Help
Entry
Cyan10605_1248    CDS       T02376                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
can  Cyanobacterium aponinum
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:can00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1505018..1505581)
Genome map
AA seq 187 aa AA seqDB search
MNRKIKLYGGSRSRASIIQWYLEEIGADYEFILLDMANKEHLSPEFLKLNPMGKVPVIID
GDFILWESGAILLYLAEKYGQEIDSLETRSIFNQWILFANSTLSTGLFIEANREREISKL
LPPLEKILQSHSFLLGDKLTVADIAVGSMLAYTQILLKLNLRDYPAISNYIDTISQRPAF
SKTIGNR
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaataggaaaataaaactttacggaggaagtcgcagtcgtgcttctattattcaatgg
tatcttgaggaaataggagcagattatgagtttattctcctcgacatggcaaataaagaa
catttatccccagaatttttaaaactaaaccccatggggaaagttcccgtaattatagac
ggagattttattctttgggaatcgggagcaatattgctatacttagcagaaaaatatggt
caggaaattgactctttagaaacaagaagtatttttaatcaatggattttatttgctaat
tccaccctctctacaggtttatttatagaagcgaatcgggaaagggaaatatcgaaacta
cttcctcctttagaaaaaatcttacaatcccattcttttctcttaggagacaaattaacg
gttgccgacatcgcagttggttctatgttggcttacactcaaattttgttgaaattaaac
ttgagggattatcctgctattagcaattatattgacacaatctctcaacgtcctgctttc
agtaaaactattggcaacagataa

DBGET integrated database retrieval system