KEGG   Cyanobacterium aponinum: Cyan10605_1797Help
Entry
Cyan10605_1797    CDS       T02376                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
can  Cyanobacterium aponinum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:can00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Cyan10605_1797
Enzymes [BR:can01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Cyan10605_1797
Exosome [BR:can04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cyan10605_1797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2153921..2155411
Genome map
AA seq 496 aa AA seqDB search
MDKYILAIDQGTTSSRALIFNKDGNVISSAQQEFTQYYPNPGEVEHDPLEIWQSVLSVVE
KAIEQGNIEKKQIEGIGITNQRETTVVWNKETGKPIYNAIVWQDRRTSAKIDNLKERELQ
KEVKNRSGLLLDAYFSASKVEWILDHVENARNLANQGKLAFGTIDSWLIWHLTGGKKHIT
DVSNASRTLLLNVNKVKWDVVLLDLFNIPESMLPQLCDNSGIVAYTSSEVFGEQIPISGV
AGDQQAATFGHTGFHKGIAKNTYGTGCFLISPTGKTLVPSAKSLLSTICWRFNNEITYGL
EGSILASGSAITWLRDGLGIINNADEVNTLANSVPDTGDVYFVPALAGLGSPYWDQYARG
TIVGIDRGTTKAHIARATLEGIAFQVYDVVKALEEDSHTPLELLTVDGGAARSDFLLQFQ
ADILGIPVERPQEIELTAKGVGYLAGLGVGYWDNLSQIQQIKSDTKVFEPKMSENERKQR
CDRWLEAVNRAKTWAS
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggataaatacattttggcaatcgatcagggaacaaccagttcgagagcattaatattt
aacaaagatggtaacgttatttcttcggcacagcaagagtttacccaatactatcctaat
cccggagaagtagaacacgatccccttgaaatttggcaatctgttttatcagtggtagaa
aaagccattgaacaaggaaatattgagaaaaaacaaatagagggtattggcatcaccaat
caacgagaaacaacggttgtgtggaataaggagacggggaaacctatttataatgcaatt
gtttggcaagacagaagaacttcagcaaaaattgacaatcttaaggaaagagaattacaa
aaagaggttaaaaatcgctcgggattgcttttagatgcttatttctctgctagtaaagta
gaatggattttagaccatgtagaaaatgctcgaaatcttgcaaatcaaggaaaactagct
ttcggtacgatcgattcttggttaatttggcatttgacggggggcaaaaaacatattacc
gatgtaagtaacgcttctcgcacccttttactcaatgtcaacaaggtaaagtgggatgtt
gttttattagacttattcaatattcccgaatctatgttacctcaactatgcgataatagt
ggtatcgttgcatacacttcttcagaagttttcggagagcaaatacccatttcaggagtt
gcaggggatcaacaagcggcaacctttggacatacaggctttcataagggtattgctaaa
aatacatacggcacgggttgctttttaatttctcccacaggtaaaactttagtaccttct
gctaaaagcctcttgtcaactatttgttggcgttttaataacgaaattacttacggttta
gaaggcagtatattggctagtggttcggcaattacatggttaagagatggtttaggtatc
atcaataatgccgatgaagtaaataccctagctaattcagtgcctgatactggagatgtt
tattttgttcctgctttagctggtttaggttctccttattgggatcaatatgctcgtggt
acaatcgttggaatagacagaggtacaacaaaagctcacattgcaagggcaactttagag
ggtattgcttttcaagtttatgatgtagtaaaggctttagaagaagactcccatacacct
ttggaattattaactgttgatggtggggcggcaagaagtgatttccttttgcaatttcaa
gctgatattctcggcattcctgtggaaagaccccaagaaattgagcttacagcaaaaggt
gttggttatcttgcaggtttaggagttggttactgggataatttaagccaaattcagcag
attaaaagtgatactaaagtttttgaaccaaaaatgtcggaaaatgaacgaaaacaaaga
tgcgatcgctggctagaagctgttaatcgtgctaaaacttgggcttcataa

DBGET integrated database retrieval system