KEGG   Cyanobacterium aponinum: Cyan10605_1813Help
Entry
Cyan10605_1813    CDS       T02376                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
can  Cyanobacterium aponinum
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:can00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Cyan10605_1813
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Cyan10605_1813
Enzymes [BR:can01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Cyan10605_1813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2170779..2173187)
Genome map
AA seq 802 aa AA seqDB search
MLKIELPQIPSSAWQCEIGKEWEKPYTVRYASNLDDGANHGMPLGGFGGGCVGRGVNGEF
NLWHIDGGNHIYQSLPACQFSVFEQVEGEPPQVYAMSTNSPTDGSLSSWAWYPQGKGTYS
ALYPRSWFDYQGVFKSRLICEQFSPIWAGSYQESSYPLAVFEWSVHNPTDKEITLSIMFT
WQNSVGWFTNAIKSPTVKVRDDGSPEYEYRPKWGDSTGNLNQWIQDNFRVGCLFDRIRME
EQPQEGEGQWAISSITNPSLEVFYHSRWNPKGDGADIWDYFAMNGSLPDYQDETPAEPGE
QIAGAMAIRFTVKPGKTKKIPFILAWDFPVTEFAQGITYYRRYTDFFGRNGRNAWAIVRT
ALKHHDMWQNRIKEWQKPILDRGDLPEWLKMALFNELYLLSEGGSLWTAATENDPVGQFG
VLECIDYRWYESLDVRLYGSFPLIMMWPRLDKSIMEAFSRAIPTEDKTPRIIGYNQTQAI
RKAKGATPHDLGAPNEHPWEKSNYTSYQDCNLWKDLGCDFVLLVYRDYLFTGGLDQDFLW
ECWDSVVETLHYVKTFDLDGDGIPENSGAPDQTFDDWRLQGISAYCGGLWIAGLEAAIAI
GNTLIANPPMNPSLQPDDYPQGIKDAIAVFQQWLTQARSLYHETLWNGEYYRLDSESGSD
VVMADQLCGQFYAQLLGLPDVVESKYVKSTLRKVYDACFLKFHDGKFGIANGVKPDGKPV
KENDTHPLEVWTGINYGIVAFMILNGMKQEGLRVAETVVKQVYENGLQFRTPEAITAVGT
FRASHYLRAMAVWAIYYSLEKK
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaatcgaactacctcaaattccttcctctgcatggcaatgtgaaatcggcaaa
gaatgggaaaaaccctatacagtacgctacgctagcaatttagatgatggagctaatcat
ggtatgcctttgggtggttttggtggtggttgtgttggtagaggggtaaatggtgaattt
aatctttggcacattgatggtggtaatcatatttatcagtctttaccagcttgtcagttt
agtgtttttgagcaagtagaaggagaacctccccaagtatatgccatgagtactaattcc
cctactgatggtagtttatcaagttgggcatggtatccccaaggaaaaggtacatattcc
gcactttatcctcgtagttggtttgactatcaaggggtgtttaaatctcgtcttatctgt
gagcagttttctcctatttgggcaggaagttaccaagaatctagttatcctttggctgtg
tttgagtggagtgtgcataatcctactgataaggaaataaccctgagtattatgtttaca
tggcaaaatagtgtgggttggtttactaatgctattaagtctcccactgtaaaagttagg
gatgatggtagtcctgagtatgaatatcgaccaaaatggggagatagcacgggtaatctt
aatcagtggattcaggataattttagggtaggatgtttgttcgatcgcatccgtatggaa
gaacaaccccaagaaggggaggggcaatgggcaatttctagcattacaaaccctagctta
gaagtcttttatcatagtcgttggaatcccaagggagatggtgcagatatatgggattat
tttgccatgaatggctctttaccagattatcaggatgagacacccgccgaacccggagaa
caaattgcgggggcaatggcgattagatttacagttaaacccgggaaaacaaaaaaaatt
ccttttatcctagcatgggactttcctgtaaccgaatttgcccaaggaatcacttattat
cgccgttatacggatttttttggtagaaatggtcgtaacgcttgggcaattgtacgcaca
gcattgaaacaccatgatatgtggcaaaatcgcattaaagagtggcagaaaccaatccta
gatcgaggtgatttaccagaatggctaaaaatggctttatttaacgaattatatttgttg
agtgaaggaggaagtttatggactgcggcaacagaaaatgaccctgtgggacaatttggg
gttttagaatgtattgattatcgttggtatgaaagtttagatgtacgtttatatggttct
tttcctctaatcatgatgtggcctcgtttagataaatcaattatggaggcttttagtcgg
gcaattcctacagaagataaaacccctcgtatcatcggttataatcagacacaggctatc
aggaaggcaaaaggagcaaccccccacgatttaggcgcaccaaatgagcatccttgggaa
aaaagtaactataccagttatcaagactgtaatttatggaaagatttgggctgtgatttt
gttttgctagtttatcgagattatttatttactggtggtttagatcaagatttcttgtgg
gaatgttgggatagtgtggtggaaactctccattatgtgaaaacttttgatttagatggt
gatggtatccctgaaaattctggcgctcctgatcaaacttttgatgattggcgtttacag
ggtattagtgcttactgtggcggtttatggattgcaggattagaagcggctatcgctatt
ggcaatacattgattgcaaatccccctatgaatcctagtttacaacctgatgattacccc
caaggaattaaagatgcgatcgcagtttttcaacaatggttaactcaagcaagaagtctt
tatcatgaaactctttggaatggggaatattaccgcctcgacagtgaaagtggttcagat
gtggttatggctgatcaactatgcggacagttttatgctcaattattaggattacccgat
gttgtagaatcgaaatatgtaaaatctaccctcagaaaagtatatgatgcttgtttctta
aaatttcatgatggtaaatttggtattgccaatggagtaaaacccgacggaaaacctgtt
aaagaaaatgacactcatcctttagaagtgtggacaggtattaattatggtatcgttgct
tttatgattctcaacggcatgaaacaagaggggttaagagtcgcagaaacggtggtgaaa
caagtctatgaaaatgggctacaatttcgcacccctgaagcgattacagcagtaggtaca
tttcgagcgagtcattatctaagggcaatggcagtgtgggctatttactatagtctggag
aaaaaatag

DBGET integrated database retrieval system