KEGG   Cyanobacterium aponinum: Cyan10605_1844Help
Entry
Cyan10605_1844    CDS       T02376                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
can  Cyanobacterium aponinum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:can00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cyan10605_1844
Enzymes [BR:can01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Cyan10605_1844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2205510..2206097)
Genome map
AA seq 195 aa AA seqDB search
MIHDQPQEVNSLVSIMTKNYQEISTSSGYQNAFPNETLSVIALGSNLGDSQKILNEAIFT
LKETEKIQLINHSHWYQTKPVGPPQPDYLNGCAIINTTLSPHQLLNTLLEIEKKFGRERK
EKWGARTLDLDLIFYGDLILNTSTLEIPHPRMRERTFVLEPLAEIAPHWIDPVTGLRVSE
LLINISENKTLNLEA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgatacatgatcagccccaagaggttaatagtttagtatcaattatgacgaaaaattac
caagaaataagtacttcatcaggataccaaaatgcgttccccaatgaaaccctctcagta
attgctttggggagtaacttaggagatagtcagaaaattttaaatgaagccattttcacc
ctcaaagaaacagaaaaaatacaattaattaatcattcccattggtatcaaaccaagccc
gtaggacctcctcaaccagactacttaaatggctgtgccattatcaatacaactcttagc
cctcatcaactgctcaacactttgctcgaaatagaaaaaaaatttggcagggaaagaaaa
gaaaaatggggagctcgcacccttgacctagatttaatcttttatggagacttaatttta
aatacttccaccctagaaattcctcatccaagaatgagagaaagaacctttgtccttgaa
ccccttgcagaaatagccccccattggattgatcccgtaacgggtttaagggtatctgaa
ttactaatcaacatctcagaaaataagacgttaaatttagaggcttag

DBGET integrated database retrieval system