KEGG   Cyanobacterium aponinum: Cyan10605_2103Help
Entry
Cyan10605_2103    CDS       T02376                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
can  Cyanobacterium aponinum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:can00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Cyan10605_2103
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Cyan10605_2103
Enzymes [BR:can01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Cyan10605_2103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2530211..2531701)
Genome map
AA seq 496 aa AA seqDB search
MKLRQLLADLNYLTPLTNHPNWDQEVKGITTNSHSCGIGDVFIGMPGTRVDGGEFWQSAL
AEGAIASIISQEASQKIPPTDNDCVIVADDIPSICADIASKFYGYPSEKLKMVGVTGTNG
KTTTTHLIEFFLNQAVQKTALFGTLYARWQDYQKTATHTTPFAVDLQAQLAEALEAKNEY
VVMEVSSHALAQKRIRGCHFDVAVFTNLTQDHLDYHKDMEDYFEAKALLFSEDYLRGRAI
INYDDDYGQRLIQRLAQKQVWSYSVNNTSADLYTSDLTYQADGVKGILHTPEGSINFSSP
LVGQFNLSNLLASVGAVLSLGVSLEVITENLSAFAGVPGRMERVHFLPHQDISVIVDYAH
TPDSLENLLQAARPFISGKMICVFGCGGDRDRTKRPIMGKIAAQGADIVVVTSDNPRTEN
PEQILADILTGIPEDIKPIVQCDRALAIQEAISMAQSGDGVLIAGKGHEDYQILGTEKIH
FDDREEARKALSQKGN
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacgtcaattattagctgatttaaactatttaacccctcttacgaatcatcct
aactgggatcaggaagttaaaggtattacgacaaattctcatagttgtggtattggtgat
gtttttattggtatgcccggtactagagttgatggaggtgagttttggcaaagtgcattg
gcagaaggtgcgatcgcatctattattagtcaagaagcaagtcagaaaatcccccctacg
gataatgattgtgtaatagttgccgatgatataccttcaatctgtgcagacatagcctct
aaattttatggttatcctagtgaaaaattaaagatggtgggggttacaggtactaatgga
aaaactaccaccactcatttaatcgaattttttttgaatcaggctgttcagaaaaccgcc
cttttcggtactttatacgctcgttggcaggattatcagaaaaccgcaacccataccact
ccttttgcagtagatttacaagcacagttagcagaagccctagaagcaaagaatgaatat
gtagtgatggaagtaagttctcatgctctagcccaaaaaagaatcagaggttgtcatttt
gatgtagctgtgttcactaatttaactcaagatcatcttgactatcataaagatatggaa
gattattttgaagctaaagccttactattttctgaagactatttaagggggagagcaatt
attaattatgatgatgattatggacaaagattaattcagcgtcttgctcaaaaacaagtt
tggagttacagcgtcaacaacacctcggcagatttatacaccagtgatttaacttatcag
gcagatggggttaaagggattttgcatactccagagggtagtatcaattttagttctcct
ttagtagggcaatttaacctctcgaatttacttgccagtgtcggtgcagtattatcttta
ggggtgagcttggaggtgattacagaaaacctctcagcttttgccggtgtgccaggaaga
atggaaagggtgcattttttgcctcatcaagatataagtgtgatagtggattatgctcat
acccctgatagtttagaaaatcttttacaagccgctcgtccttttatttctggtaagatg
atttgtgtatttggttgtggaggcgatcgcgatcgtaccaaacgccctataatgggtaaa
atagccgctcagggtgctgatatagtggtagtgacttcagataatcctcgcacagaaaac
ccagaacaaatccttgcagatattctcacaggtattcccgaagatattaaacctattgta
cagtgcgatcgagctttagcaattcaagaagcaatttctatggcacaatcaggagacgga
gttttaattgcaggaaaaggccatgaagactatcaaatccttggtacagaaaaaatccat
tttgatgatagagaagaagcaagaaaagctctaagtcaaaagggcaattaa

DBGET integrated database retrieval system