KEGG   Cyanobacterium aponinum: Cyan10605_2210Help
Entry
Cyan10605_2210    CDS       T02376                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
can  Cyanobacterium aponinum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:can00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cyan10605_2210
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cyan10605_2210
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cyan10605_2210
Enzymes [BR:can01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cyan10605_2210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2649780..2651087
Genome map
AA seq 435 aa AA seqDB search
MTQAIARTTDNKLKPTFTKLVSKEGSAEYPLKAIHICEETFAPLEVAYDYDAIKAQVSRE
SIAAGPNSIWRYKAFLPVESENPIDVGTGMTPLVKSTRLARRLGLKNLYIKNDAVNMPTL
SFKDRVVSVALTRARELGFTTVSCASTGNLANSTAAIAAHAGLDCCVFIPSDLEAGKVLG
TLIYNPTVMAVKGNYDQVNRLCCEVGNTYGWGFVNINLRPYYSEGSKTLGFEVAEQLGWK
LPDHIVAPLASGSLFTKIYKGFQEFVKVGLVDDKAVRFSGAQAEGCSPIAQAFREGRDFV
TPVKPNTIAKSIAIGNPADGMYALDIARKTNGNIESVTDAEIIEGIKLLAETEGIFTETA
GGTTVAVLKKLVEAGKIDPEESTVVYITGNGLKTQEAVQGYISEPLIIEPKLDSFERALE
RSRTLDRLEWQQVLV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagcgatcgcacgtaccacagacaataaattaaaacccactttcaccaaatta
gtatctaaagaaggaagtgcagaataccctctcaaagcgattcatatttgtgaggaaacc
tttgcacccctagaagtagcctacgactatgatgccatcaaagctcaagtaagtcgtgaa
tccatcgccgccggacctaattccatttggcgttacaaagcatttttacccgtagaaagt
gagaatcctattgatgtgggtacaggtatgactcctttggtcaaatccacccgcttggct
cgtcgtttaggtctgaaaaatctttatattaaaaatgatgctgttaatatgcctaccctc
agctttaaggatagagtcgtttccgtggctctaacccgtgctagagagttaggttttacc
accgtttcctgtgctagtactggtaatttagccaattctacggctgcgatcgctgctcat
gctggtttagactgttgtgtcttcattccttctgatttagaagcaggaaaggttttaggt
acattaatctataaccccactgtcatggctgttaaaggtaactatgatcaagttaatcgc
ctctgttgtgaagttggtaacacctatggttggggatttgttaacattaacttacgtcct
tactactctgaaggttcaaaaaccctcggttttgaggtagcagaacaattaggctggaaa
ttacctgatcacatcgttgcacctttagcttctggttctcttttcaccaagatttataaa
ggtttccaagaattcgtcaaagtcggtttagtggatgataaagcagtgcgtttcagtggt
gctcaggcggaaggatgttctcctattgctcaagcattcagagaaggcagagattttgtc
acccctgttaaacccaataccattgctaagtcgatcgccattggtaatcctgctgacggt
atgtatgcgttagatattgctcgtaaaactaacggtaatatcgaatctgtcaccgatgca
gaaattattgaagggatcaaactcttagcagaaactgaaggtatctttactgaaactgca
gggggtacaaccgttgccgtattgaaaaaattggtagaagcgggaaaaattgatcctgaa
gaaagcaccgttgtttatatcactggtaatggcttgaaaactcaagaagctgtacaagga
tacatcagcgaacctttaatcattgagcctaaattagacagttttgaaagagctttggag
cgttctcgcaccctcgatcgtttagaatggcaacaagtattagtataa

DBGET integrated database retrieval system