KEGG   Cyanobacterium aponinum: Cyan10605_2245Help
Entry
Cyan10605_2245    CDS       T02376                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
can  Cyanobacterium aponinum
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:can00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Cyan10605_2245
Enzymes [BR:can01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Cyan10605_2245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2680218..2681117
Genome map
AA seq 299 aa AA seqDB search
MKQFLESEIISTYEEAKIVILPIPYEITTTYRKGCEYGPDAVLTASDQLECYDEELGMET
CFHAPIFTHDYIADTRINKNLTADDMLKVTTETVTKLIKDNKFVIAVGGEHAITTGVVQA
YQQTLDEPFTVIQIDAHGDMRHEFEGSIHNHACVMRRILELDLPTLPVGIRAICQEEADL
IKEKNIPVMWARNIYFNPHWMAEAISNIKTKKVFITIDLDGIDPSLMPGVGTPEPGGMDW
YQLLAFMNLIFSSFDVIGCDVMELAPTKDSVVSEFTAAKLIYKLIGYWQQNNSKVRSIE
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagtttttagaatcagaaattatctctacttatgaagaagcaaaaatagttatt
ttaccaatcccctatgaaattactactacctatcgtaaagggtgcgaatatgggcctgat
gccgtattaactgcctctgatcagctagaatgttatgacgaagaattaggaatggaaact
tgttttcatgcccctatttttacccatgactatatcgccgatacccgcatcaacaaaaat
ctaacggcagatgatatgttgaaagtcacaacagaaaccgttacaaaattgatcaaagat
aataaatttgtcattgccgttggcggagaacacgctatcacgacaggagtagtccaagcc
tatcaacaaacccttgatgaaccctttacagtaatacagatagatgctcatggagatatg
agacacgaatttgaggggtcaattcataatcatgcttgtgttatgagaagaatattagaa
ttagacttgccgacattaccagtgggaatcagagcaatttgtcaagaggaagctgattta
atcaaagaaaaaaatatacccgtaatgtgggcgagaaacatttattttaatccccattgg
atggcagaagctatcagtaacataaaaacgaaaaaagtattcattaccattgatttagac
ggaattgaccctagtttaatgcccggagttggtacgcctgaacccggtggcatggactgg
tatcaactattagcttttatgaatttaattttttcgagctttgatgtaattggctgtgat
gttatggaattagcaccaacaaaagattccgttgtttctgaatttactgcggctaaacta
atctataaattaattggctactggcaacaaaataactcaaaagtcagaagtatagagtga

DBGET integrated database retrieval system