KEGG   Cyanobacterium aponinum: Cyan10605_2368Help
Entry
Cyan10605_2368    CDS       T02376                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
can  Cyanobacterium aponinum
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:can00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cyan10605_2368
Enzymes [BR:can01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Cyan10605_2368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2819571..2821499)
Genome map
AA seq 642 aa AA seqDB search
MTEFKDFDQQLLTQIKILLEKLDKKSENRKKLQNILKILKNQDNLQDKEGGYSEKFDQKK
FDNQKYFNLKIKPLLDVLYTPEISENLLGIIYNLIEDKFAESLTINWHKWSENNVQLITY
GDTIKDSKSSEKPLVTLANFLEDYLQDTITGVHILPFNPYSSDDGFAVIDYLQVDEKLGD
WDDISAIALQFNLMIDLVINHVSRQHQWFKNFQEGKEPECNYFITVDPDTDLSSVVRPRS
TPLLTKVETKTGEKYVWSTFSADQIDVNFANPDVLLEYIKIIIFYIELGIKYIRLDAVGF
LWKKIGTTCIHLPETHTIIRLIREICQMLDPTIAIITETNVPNWENLSYFGNGNEAHMIY
NFSLPPLLLNALIQGRSDHLKTWMMRMPPAPKGCAYFNFTASHDGIGLRPAEGLLREEEY
QTLLTKMQEFGGKISYRQQPDGSESPYEINISWFSAMKGTMEGEDQWQIERFLCSQTIML
ALEGIPAFYIHSLLATSNNEENVVKTGQNRAINRHKWDYQELKALLENPQSDQSIVLNKL
SRLIKIRRQQPAFHPNATQYTLHPLNRALFTFWRQSSDRAQSIFCIHNLSKQRQNLILSQ
LNLIDTEKWFDLISHSAIENIHDKYTLQPYQCLWITNYRAYK
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgactgaatttaaggattttgatcagcaattactaacacaaattaaaattcttttagaa
aaattggataaaaagtcagaaaatagaaaaaaattacaaaatatactcaaaatacttaaa
aatcaagataatctccaagataaagaaggtgggtattcagagaaatttgatcagaaaaaa
tttgataatcaaaaatattttaatttaaaaattaagcctttattagatgttttatataca
ccagaaataagcgaaaatttattagggataatttacaatttaatagaggataaatttgct
gaatctttgacgattaattggcataaatggagcgaaaataatgtacagttaatcacctat
ggggatactataaaagacagtaaatcttcagaaaaacctctagttactcttgctaatttt
ttggaggattatcttcaggatactattacaggagttcatattctaccatttaatccctac
agttctgatgatggttttgctgtgattgattatttacaagtggacgaaaaattaggcgat
tgggatgatataagtgcgatcgcacttcagtttaatttaatgatcgatttagtgattaat
cacgtttcgaggcaacatcaatggtttaaaaattttcaagaaggaaaagaacctgaatgt
aactattttataaccgttgatcctgatactgacttatcctccgttgttcgtcctcgtagt
acgccattgctaacgaaagtagaaaccaaaacaggagaaaaatatgtttggagtaccttt
agtgctgatcaaatagatgttaattttgccaatcctgacgtattactggagtatatcaag
attattattttttatattgaactaggaattaaatacattcgtcttgatgcagtgggattt
ctttggaaaaaaattggcacaacttgcattcatcttcctgaaactcatactataattcgc
ctgattagggaaatttgtcaaatgctagatcccaccattgctattattacagagacaaat
gttcctaactgggaaaatttgagctattttgggaacggcaatgaagcccacatgatttat
aactttagtttgcctcccctattattaaatgctttaatacaaggaagatcagaccatcta
aaaacatggatgatgagaatgccccctgcccctaaaggatgtgcgtattttaactttacg
gcttcccatgacggtattggtttacgcccggcagaagggttattaagagaggaagaatat
caaaccttattgacaaaaatgcaggaatttggcgggaaaatcagctatcgtcaacagcct
gatggtagtgaatccccctatgaaataaatatttcttggttttctgccatgaaaggtaca
atggaaggggaagaccaatggcagatagaaaggtttttatgttctcaaactatcatgtta
gctttggaaggaattccagcgttttatattcatagtttgttagcaacaagcaataatgaa
gagaatgtggtcaaaacggggcaaaatcgtgctatcaatcgtcataaatgggattatcaa
gagttaaaagcactattagaaaaccctcaatctgaccaaagtattgttttaaacaaatta
tctcgtttaatcaagattcgtcgtcaacaaccagcttttcatcctaatgcaacccaatat
actttacatcccttaaatcgggcattatttacattctggagacaaagtagcgatcgcgcc
cagagtattttctgcattcacaatcttagcaaacaaagacaaaatctaatcctatctcaa
cttaacctgattgatacagaaaaatggttcgacttaattagtcatagtgcgatcgaaaat
atccatgataaatatactttacaaccttatcaatgtctttggattacaaactatagagcc
tataaataa

DBGET integrated database retrieval system