KEGG   Cyanobacterium aponinum: Cyan10605_2448Help
Entry
Cyan10605_2448    CDS       T02376                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
can  Cyanobacterium aponinum
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:can01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:can00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2903425..2904717
Genome map
AA seq 430 aa AA seqDB search
MLRIITDQGEARQELQRISERTYHENIETQSATVREIIATVKKNGDRALLEYTEKFDGQV
IPPEKLKVSGSEIDAAYQQISPDLLQAIKLAATKIEAFHQQRTPKSWVQFAEDNVVLGRR
YTPVDRAGLYVPGGRASYPSTVLMNAIPAKVAQVPRIVMVTPPSEGGKINPAVLVAASEA
GVTEIYRVGGAQAVAALAYGTETIPRVDVITGPGNIYVTLAKKEVYGRVGIDSLAGPSEV
LIIADSQANPVHVAVDLLAQAEHDPMAAAILVTDSELLAQQVQAEVDQQLENHPRRTLTE
KAIAHYGVIILTKNLTEAAELSNLFAPEHLELEVESPWDLLEHIRHAGAIFLGNSSPEAV
GDYLAGPNHTLPTSGAARYASALGVETFMKYSSIIEYSPSALQKVSKAIIDLTIAEGLPS
HGNSVKYRTK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgaataataacagaccaaggcgaagcacgacaagaattgcaacggattagtgag
cggacttatcatgaaaacatagaaacacaatcggcaacggtgcgagaaattatcgctaca
gtcaagaaaaatggcgatcgcgcccttttggaatatacagaaaaattcgatggacaagta
attccgcccgaaaaactgaaagtaagtggctcagaaattgatgcggcttatcaacagatt
tcccctgatttacttcaggcaataaaattggcagcaacaaaaatcgaggcttttcaccaa
caacgcacccccaaatcatgggtacaatttgcagaggataatgtggtattgggcagacgt
tatacccccgttgatagagcaggtttatatgtaccagggggaagagcttcttatcctagc
accgtgttaatgaatgccatacccgccaaagttgctcaagtgcctcgtattgtaatggtg
acacccccttcagaaggtggtaaaatcaaccccgcagttttagtggccgctagtgaagca
ggagtaacagaaatttatcgagtaggtggggcgcaggctgtggcggcattagcttatggt
acagaaactattcctagagtggatgtcatcactggtcctggaaatatatatgtaacccta
gcaaaaaaagaagtatatggcagagtcggcattgattctttagcaggtcctagcgaagtt
ttaattattgctgatagtcaagcgaatccagtacatgtggctgttgatttattagcccaa
gcagagcatgatcccatggcggcggctatattagttacagatagtgagttattagctcaa
caagtccaagctgaagttgaccaacagttagaaaatcatccccgtcgtactcttactgaa
aaagcaattgcccattatggggtaattattcttacgaaaaatttaaccgaagccgccgaa
ctatcaaacttattcgctcctgaacatttagagctagaagtagaatctccttgggattta
ttagagcatattcgccatgccggggctattttcttaggtaattcttcccctgaagcggta
ggagactatttagcggggcctaatcatactttaccaacttctggagcggctcgttacgct
tctgctttaggagtagaaactttcatgaaatactcaagcatcatcgaatatagtccatct
gctttacaaaaagtgtctaaggcaattattgatttaactattgcagagggtttaccatcc
catggtaattcggtgaaatatcgcacaaaataa

DBGET integrated database retrieval system