KEGG   Cyanobacterium aponinum: Cyan10605_2562Help
Entry
Cyan10605_2562    CDS       T02376                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
can  Cyanobacterium aponinum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:can00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cyan10605_2562
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Cyan10605_2562
Enzymes [BR:can01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Cyan10605_2562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3045051..3046163)
Genome map
AA seq 370 aa AA seqDB search
MSKTIVVKIGTSSLTRLETGNLALSTIASLVETLTNLRQQGNRVILVSSGAVGVGCGRLC
LTERPRNINIKQAIAAVGQGRLIRVYDDLFSNLGQPIAQILLTRRDLMDRNSYVNANNTF
NALFELGVIPIVNENDTVATDELKFGDNDTLSALVASLVEADWLFLLTDVDKLYSADPRI
VPSAVPIDLVNSDEFAQLEINVSEGGSGWGTGGMITKLRAAKIASSAGVTTVITNGKTPY
NISKIIAGEAIGTKFTAQPKTENARKRWIANGLVSTGRIHLDDGAVNALCKQGKSLLAAG
ITTIEGNFSVSDAVDLINSQGEIIGKGIVNYSYDDLDLVKGQKSANISQILGYQTPETVI
HRDNLVIFDN
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaactatagttgtcaaaattggcacttctagcttaaccagactggaaacaggt
aatttagccctttcaactattgctagtttagtggaaactctcacaaatttacgtcaacaa
ggtaatcgggttattctcgtttcttctggagcggtaggagtaggctgtgggagactttgt
ttgactgaacgccctcgtaatattaacataaaacaagcgatcgcagccgttggacaagga
agattaatcagagtttatgatgatttatttagtaacctcggacaacccatcgcccaaatt
ctcttaactagaagggatttaatggatagaaactcctatgtaaatgcaaacaatactttt
aatgctttgtttgagttaggagtaattcccatcgtcaatgaaaatgatactgttgctacg
gatgaattgaaattcggagataatgacactctttcggcattagtagcgagtttagtagaa
gcggattggttatttttattaacggatgtggacaaactttattcggcagaccctcgtatt
gtaccctctgccgttcctatcgatctagttaatagtgacgaatttgcccaactggaaata
aatgttagtgaaggaggtagtggttggggtactggtggtatgattacaaagttaagggcg
gcaaaaattgcttctagtgctggagtaacgacggttatcactaacggaaaaacaccctat
aatattagcaaaattatagcaggagaggcgatcgggacaaaatttacggctcaaccaaaa
acagaaaatgctcgtaaacgttggatagcaaatggcttagtttccacgggtagaatccat
ttagatgatggggcagttaatgctctttgtaaacaaggaaaatctttactggcggctgga
attactactatagaaggcaattttagcgtttctgatgctgtggatctcatcaattctcag
ggagagattatcggcaagggtattgttaattatagttatgatgatttagatttagtcaaa
gggcaaaaatccgccaatatttcccagattctaggttatcaaacccctgaaactgttatt
catcgagataatctagttatttttgataattaa

DBGET integrated database retrieval system